Comparing BPHYT_RS09285 FitnessBrowser__BFirm:BPHYT_RS09285 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7rsfA Acetylornithine deacetylase from escherichia coli
33% identity, 80% coverage: 72:395/404 of query aligns to 63:375/380 of 7rsfA
7uoiA Crystallographic structure of dape from enterococcus faecium
28% identity, 80% coverage: 75:396/404 of query aligns to 64:380/383 of 7uoiA
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
27% identity, 95% coverage: 17:398/404 of query aligns to 8:359/366 of Q8P8J5
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
26% identity, 95% coverage: 17:398/404 of query aligns to 9:354/360 of 2f7vA
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
29% identity, 80% coverage: 72:394/404 of query aligns to 53:371/377 of P44514
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
29% identity, 80% coverage: 72:394/404 of query aligns to 57:375/380 of 5vo3A
7lgpB Dape enzyme from shigella flexneri
32% identity, 53% coverage: 75:288/404 of query aligns to 60:273/377 of 7lgpB
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
32% identity, 51% coverage: 83:290/404 of query aligns to 64:274/377 of 7t1qA
Sites not aligning to the query:
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
31% identity, 48% coverage: 81:274/404 of query aligns to 62:258/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
31% identity, 48% coverage: 81:274/404 of query aligns to 62:258/375 of 4pqaA
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
37% identity, 28% coverage: 72:185/404 of query aligns to 55:172/258 of 4h2kA
Sites not aligning to the query:
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
26% identity, 75% coverage: 81:383/404 of query aligns to 99:406/426 of 3pfoA
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
32% identity, 42% coverage: 12:181/404 of query aligns to 1:166/265 of 4op4B
Sites not aligning to the query:
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
26% identity, 52% coverage: 69:280/404 of query aligns to 64:281/407 of P37111
Sites not aligning to the query:
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
26% identity, 52% coverage: 69:280/404 of query aligns to 64:282/408 of Q03154
Sites not aligning to the query:
1cg2A Carboxypeptidase g2 (see paper)
25% identity, 72% coverage: 10:299/404 of query aligns to 11:288/389 of 1cg2A
Sites not aligning to the query:
P06621 Carboxypeptidase G2; CPDG2; Folate hydrolase G2; Glutamate carboxypeptidase; Pteroylmonoglutamic acid hydrolase G2; Glucarpidase; EC 3.4.17.11 from Pseudomonas sp. (strain RS-16) (see paper)
25% identity, 72% coverage: 10:299/404 of query aligns to 36:313/415 of P06621
Sites not aligning to the query:
7m6uB Crystal structure of a circular permutation and computationally designed pro-enzyme of carboxypeptidase g2 (see paper)
26% identity, 58% coverage: 65:299/404 of query aligns to 4:223/392 of 7m6uB
Sites not aligning to the query:
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
30% identity, 42% coverage: 40:210/404 of query aligns to 81:264/503 of Q8C165
Sites not aligning to the query:
1lfwA Crystal structure of pepv (see paper)
33% identity, 34% coverage: 62:199/404 of query aligns to 65:197/468 of 1lfwA
Sites not aligning to the query:
>BPHYT_RS09285 FitnessBrowser__BFirm:BPHYT_RS09285
MSHVAETAQSTSSSPVSLPWVTRLVSMDTVSRNPNLGLIETVRDELRAVGVEATLTHDES
GKWANLFATIPAHNGETNGGVVLSGHTDVVPVDGQQWDSDPFKPEIRGDKLYGRGTCDMK
GFIGAALTLVPEMQRTKLAKPIHFALSFDEEVGCAGAPLLIADLMKRGVKPDGCIVGEPT
SMRPIVAHKGINAYQCCVRGQAAHSSLTPKGLNAIEYAARLICYIRDMADQFREQGPFDE
LYDVPFTTAQTSTIVGGNAINTVPAECKFQFEFRNLPTLDPEPIFARIDQYARETLLPKM
LREHPSAAIEITKIAAAPGLDSSEQAAITQLVRALTADQDKRKVAYGTEAGLFSLAGIPS
IVCGPGDIQQAHKPNEFVALDQLVACERFLQKFIHSMSVDAHAH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory