SitesBLAST
Comparing BPHYT_RS09815 BPHYT_RS09815 malate synthase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5oasA Crystal structure of malate synthase g from pseudomonas aeruginosa in apo form. (see paper)
67% identity, 100% coverage: 1:721/724 of query aligns to 4:723/728 of 5oasA
5vfbA 1.36 angstrom resolution crystal structure of malate synthase g from pseudomonas aeruginosa in complex with glycolic acid.
67% identity, 99% coverage: 8:721/724 of query aligns to 7:719/724 of 5vfbA
P37330 Malate synthase G; MSG; EC 2.3.3.9 from Escherichia coli (strain K12) (see 2 papers)
64% identity, 100% coverage: 1:722/724 of query aligns to 1:721/723 of P37330
- M1 (= M1) modified: Initiator methionine, Removed
- R338 (= R340) mutation to K: Has a specific activity which is only 6.6% of the wild-type activity.
- C617 (= C619) modified: Cysteine sulfenic acid (-SOH); mutation to S: Affinity binding for acetyl-CoA is more than five times greater than that of wild-type, although its specific activity is comparable.
- D631 (= D633) mutation to N: Absence of malate synthase activity.
- C688 (≠ I689) modified: Cysteine sulfenic acid (-SOH)
1d8cA Malate synthase g complexed with magnesium and glyoxylate (see paper)
63% identity, 99% coverage: 3:722/724 of query aligns to 1:708/709 of 1d8cA
- active site: D268 (= D271), E270 (= E273), R325 (= R340), E414 (= E429), D442 (= D457), D618 (= D633)
- binding glyoxylic acid: M412 (= M427), E414 (= E429), G439 (= G454), L441 (= L456), D442 (= D457)
- binding magnesium ion: E414 (= E429), D442 (= D457)
- binding sorbitol: Q59 (= Q61), H449 (= H464), V688 (≠ R702), K689 (≠ Q703), Q690 (= Q704), P691 (= P705)
1p7tA Structure of escherichia coli malate synthase g:pyruvate:acetyl- coenzyme a abortive ternary complex at 1.95 angstrom resolution (see paper)
63% identity, 99% coverage: 6:722/724 of query aligns to 3:705/706 of 1p7tA
- active site: D259 (= D271), E261 (= E273), R322 (= R340), E411 (= E429), D439 (= D457), D615 (= D633)
- binding acetyl coenzyme *a: V115 (= V118), V116 (= V119), P117 (= P120), R122 (= R125), Y123 (= Y126), N126 (= N129), A127 (= A130), S263 (= S275), R295 (= R312), R322 (= R340), M492 (= M510), P520 (= P538), P522 (= P540), C601 (= C619), M613 (= M631), D615 (= D633)
- binding magnesium ion: E411 (= E429), D439 (= D457)
- binding pyruvic acid: E411 (= E429), G436 (= G454), L438 (= L456), D439 (= D457), W518 (= W536)
P9WK16 Malate synthase G; EC 2.3.3.9 from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) (see paper)
62% identity, 100% coverage: 1:721/724 of query aligns to 1:722/741 of P9WK16
- R339 (= R340) active site, Proton acceptor
- D633 (= D633) active site, Proton donor
2gq3A Mycobacterium tuberculosis malate synthase in complex with magnesium, malate, and coenzyme a (see paper)
62% identity, 99% coverage: 8:721/724 of query aligns to 7:715/720 of 2gq3A
- active site: D267 (= D271), E269 (= E273), R335 (= R340), E430 (= E429), D458 (= D457), D626 (= D633)
- binding coenzyme a: V114 (= V118), V115 (= V119), R121 (= R125), F122 (≠ Y126), N125 (= N129), A126 (= A130), K301 (= K305), R308 (= R312), P539 (= P538), P541 (= P540), C612 (= C619), M624 (= M631), D626 (= D633)
- binding magnesium ion: H370 (= H375), K373 (= K378), N378 (vs. gap), G379 (vs. gap), L381 (vs. gap), E430 (= E429), D458 (= D457)
6axeA Crystal structure of a malate synthase g from mycobacterium marinum bound to acetyl coa
61% identity, 100% coverage: 1:721/724 of query aligns to 2:725/729 of 6axeA
- active site: D272 (= D271), E274 (= E273), R338 (= R340), E437 (= E429), D465 (= D457), D636 (= D633)
- binding acetyl coenzyme *a: V119 (= V118), V120 (= V119), R126 (= R125), F127 (≠ Y126), N130 (= N129), A131 (= A130), R311 (= R312), R338 (= R340), M518 (= M510), W544 (= W536), P546 (= P538), P548 (= P540), C622 (= C619), K624 (= K621), M634 (= M631), D636 (= D633)
- binding magnesium ion: E437 (= E429), D465 (= D457)
6dnpA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-f-3-methyl-6-f-phenyldiketoacid (see paper)
62% identity, 99% coverage: 8:721/724 of query aligns to 7:707/712 of 6dnpA
- active site: D270 (= D271), E272 (= E273), R328 (= R340), E419 (= E429), D447 (= D457), D618 (= D633)
- binding (2Z)-4-(2,6-difluoro-3-methylphenyl)-2-hydroxy-4-oxobut-2-enoic acid: R328 (= R340), E419 (= E429), G444 (= G454), L446 (= L456), D447 (= D457), M500 (= M510), W526 (= W536), M616 (= M631), D618 (= D633)
- binding magnesium ion: E419 (= E429), D447 (= D457)
6c2xA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-br-6-me-phenyldiketoacid (see paper)
62% identity, 99% coverage: 8:721/724 of query aligns to 7:706/711 of 6c2xA
- active site: D268 (= D271), E270 (= E273), R328 (= R340), E418 (= E429), D446 (= D457), D617 (= D633)
- binding (2S)-4-(2-bromo-6-methylphenyl)-2-hydroxy-4-oxobutanoic acid: V115 (= V118), R328 (= R340), E418 (= E429), G443 (= G454), L445 (= L456), D446 (= D457), M499 (= M510), W525 (= W536), M615 (= M631), D617 (= D633)
- binding magnesium ion: E418 (= E429), D446 (= D457)
5cahA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 6h-thieno[2,3-b]pyrrole-5-carboxylic acid (see paper)
62% identity, 99% coverage: 8:721/724 of query aligns to 7:701/706 of 5cahA
- active site: D266 (= D271), E268 (= E273), R324 (= R340), E413 (= E429), D441 (= D457), D612 (= D633)
- binding 6H-thieno[2,3-b]pyrrole-5-carboxylic acid: S270 (= S275), M494 (= M510), M610 (= M631), E611 (= E632), D612 (= D633)
- binding magnesium ion: E413 (= E429), D441 (= D457)
6dkoA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2,6-f-phenyldiketoacid (see paper)
62% identity, 99% coverage: 8:721/724 of query aligns to 7:711/716 of 6dkoA
- active site: D270 (= D271), E272 (= E273), R332 (= R340), E424 (= E429), D452 (= D457), D622 (= D633)
- binding 4-(2,6-difluorophenyl)-2,4-dioxobutanoic acid: R332 (= R340), G449 (= G454), L451 (= L456), D452 (= D457), M505 (= M510), W531 (= W536), M620 (= M631), D622 (= D633)
- binding magnesium ion: E424 (= E429), D452 (= D457)
4ex4B The structure of glcb from mycobacterium leprae
61% identity, 99% coverage: 8:723/724 of query aligns to 6:721/721 of 4ex4B
- active site: D266 (= D271), E268 (= E273), R334 (= R340), E431 (= E429), D459 (= D457), D630 (= D633)
- binding magnesium ion: N290 (≠ M295), K291 (≠ T296), H371 (= H375), N379 (vs. gap), L382 (vs. gap), T383 (≠ L381), N384 (= N382), E431 (= E429), D459 (= D457)
5c9wA Crystal structure of mycobacterium tuberculosis malate synthase in complex with (z)-n-(2-bromophenyl)-2-(hydroxyimino)acetamide (see paper)
62% identity, 99% coverage: 8:721/724 of query aligns to 7:708/713 of 5c9wA
- active site: D269 (= D271), E271 (= E273), R327 (= R340), E420 (= E429), D448 (= D457), D619 (= D633)
- binding (2E)-N-(2-bromophenyl)-2-(hydroxyimino)acetamide: V116 (= V118), R327 (= R340), M501 (= M510), W527 (= W536), M617 (= M631), D619 (= D633)
- binding magnesium ion: E420 (= E429), D448 (= D457), V464 (≠ M473), R465 (= R474), T468 (≠ D477)
5e9xA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-chloro-6h-thieno[2,3-b]pyrrole-5-carboxylic acid (see paper)
62% identity, 99% coverage: 8:721/724 of query aligns to 7:710/715 of 5e9xA
- active site: D267 (= D271), E269 (= E273), R327 (= R340), E422 (= E429), D450 (= D457), D621 (= D633)
- binding 2-chloranyl-6~{H}-thieno[2,3-b]pyrrole-5-carboxylic acid: V114 (= V118), S271 (= S275), M503 (= M510), M619 (= M631), E620 (= E632), D621 (= D633)
- binding magnesium ion: E422 (= E429), D450 (= D457)
5drcA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-hydroxy-4-(1h-indol-3-yl)-4-oxobut-2-enoic acid (see paper)
62% identity, 99% coverage: 8:721/724 of query aligns to 7:711/716 of 5drcA
- active site: D270 (= D271), E272 (= E273), R330 (= R340), E423 (= E429), D451 (= D457), D622 (= D633)
- binding (2Z)-2-hydroxy-4-(1H-indol-3-yl)-4-oxobut-2-enoic acid: R330 (= R340), E423 (= E429), G448 (= G454), L450 (= L456), D451 (= D457), M504 (= M510), W530 (= W536), M620 (= M631), D622 (= D633)
- binding magnesium ion: E423 (= E429), D451 (= D457), R468 (= R474), T471 (≠ D477)
5c9rA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 3-((4-chlorophenyl)thio)propanoic acid (see paper)
62% identity, 99% coverage: 8:721/724 of query aligns to 7:712/717 of 5c9rA
- active site: D270 (= D271), E272 (= E273), R331 (= R340), E424 (= E429), D452 (= D457), D623 (= D633)
- binding 3-[(4-chlorophenyl)sulfanyl]propanoic acid: V117 (= V118), E424 (= E429), D452 (= D457), M505 (= M510), W531 (= W536), M621 (= M631), D623 (= D633)
- binding magnesium ion: E424 (= E429), D452 (= D457)
5cjmA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 4h-thieno[3,2-b]pyrrole-5-carboxylic acid (see paper)
62% identity, 99% coverage: 8:721/724 of query aligns to 7:706/711 of 5cjmA
- active site: D270 (= D271), E272 (= E273), R328 (= R340), E418 (= E429), D446 (= D457), D617 (= D633)
- binding 4h-thieno[3,2-b]pyrole-5-carboxylic acid: V117 (= V118), S274 (= S275), M499 (= M510), E616 (= E632), D617 (= D633)
- binding magnesium ion: E418 (= E429), D446 (= D457)
5cbiA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 5-chloro-2-hydroxybenzonitrile (see paper)
62% identity, 99% coverage: 8:721/724 of query aligns to 7:714/719 of 5cbiA
- active site: D270 (= D271), E272 (= E273), R331 (= R340), E426 (= E429), D454 (= D457), D625 (= D633)
- binding 5-chloro-2-hydroxybenzonitrile: L53 (= L54), N54 (≠ A55), D57 (= D58), F125 (≠ Y126), Y138 (= Y139), D139 (= D140), Y142 (= Y143), M507 (= M510), W533 (= W536), P535 (= P538), A611 (≠ C619), M623 (= M631), M623 (= M631), E624 (= E632), D625 (= D633)
- binding magnesium ion: E426 (= E429), D454 (= D457)
5cbjA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 3-(phenylthio)acrylic acid (see paper)
62% identity, 99% coverage: 8:721/724 of query aligns to 7:704/709 of 5cbjA
- active site: D265 (= D271), E267 (= E273), R323 (= R340), E416 (= E429), D444 (= D457), D615 (= D633)
- binding (2E)-3-(phenylsulfanyl)prop-2-enoic acid: V112 (= V118), M497 (= M510), W523 (= W536), P525 (= P538), M613 (= M631), E614 (= E632), D615 (= D633)
- binding magnesium ion: E416 (= E429), D444 (= D457)
Query Sequence
>BPHYT_RS09815 BPHYT_RS09815 malate synthase
MTQMNTRGGLQVAANLDQFVETEALPGTGIDSAAFWSGFDALVHELAPKNRALLAERDRL
QTELDNWHRANPGPVRDLRAYRAFLEGIGYIVPAPASVKATTDNVDTEIAEQAGPQLVVP
LSNQRYALNAANARWGSLYDALYGTDAIPETGGAEKQKAFNPVRGAAVIAYARKFLDQAA
PLANGSHADATRYSVDGGKLVVTLKNGTSELKTPAQFIGYQGEESAPSAVLLKHNGLHFE
IQIDASDSIGRTDAAHVKDVVVEAAVSTIIDCEDSVAAVDADDKVLLYRNWLGLMTGDLT
EEVTKNGKTFTRRLNADRVYTAANGTAPVVLHGRSLLFIRNVGHLMTNPAVLTKDGHEIP
EGILDAVITTLCALHDRKHQLNSRTGSIYIVKPKMHGPAEVAFASELFSRVEDLLKLPRN
TIKMGIMDEERRTSVNLLACIAEASERVAFINTGFLDRTGDEMHSAMEAGPMMRKGDMKS
SAWIAAYERSNVLVGLSAGLRGRSQIGKGMWAMPDLMHAMLEQKIAHPKAGANTAWVPSP
TAATLHALHYHQVDVQAVQRELERTDYATVRDELLDGLLTIPVVAEAKWSDDEIRSEIDN
NAQGILGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLYHGVVKRELVEE
TFKRMAKVVDEQNAGDPLYKPMAPGFDTIAFKAAQALVFEGRQQPSGYTEPLLHKFRLEV
KKEV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory