SitesBLAST
Comparing BPHYT_RS10270 FitnessBrowser__BFirm:BPHYT_RS10270 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
28% identity, 56% coverage: 166:397/413 of query aligns to 117:348/369 of S5FMM4
- S202 (≠ L251) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ L381) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ L391) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- 81 K→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
23% identity, 96% coverage: 3:399/413 of query aligns to 2:348/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (≠ L8), G8 (= G9), G10 (= G11), V11 (≠ I12), I12 (≠ V13), V30 (= V31), E31 (≠ D32), K32 (≠ R33), E38 (= E39), A39 (≠ T40), S40 (= S41), A43 (≠ N44), G45 (= G46), L46 (= L65), V171 (≠ A223), G200 (≠ L251), G201 (= G252), W203 (= W254), G298 (= G349), R300 (= R351), P301 (= P352), Y326 (≠ N377), R327 (≠ H378), N328 (≠ H379), G329 (= G380), I330 (≠ L381)
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
28% identity, 45% coverage: 226:411/413 of query aligns to 181:367/370 of 4yshA
- active site: I262 (≠ L307), L283 (≠ R327), G305 (= G349), N335 (≠ H379), L338 (≠ T382)
- binding flavin-adenine dinucleotide: S206 (≠ L251), G207 (= G252), W209 (= W254), R307 (= R351), H332 (= H376), R334 (≠ H378), N335 (≠ H379), G336 (= G380), I337 (≠ L381)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 47, 48, 178
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
28% identity, 45% coverage: 226:411/413 of query aligns to 181:367/368 of 4yshB
- active site: I262 (≠ L307), L283 (≠ R327), G305 (= G349), N335 (≠ H379), L338 (≠ T382)
- binding flavin-adenine dinucleotide: S206 (≠ L251), W209 (= W254), R307 (= R351), H332 (= H376), R334 (≠ H378), N335 (≠ H379), G336 (= G380), I337 (≠ L381), L338 (≠ T382)
- binding glycine: G249 (≠ Q294), Y251 (= Y296), Y251 (= Y296), A264 (vs. gap), R307 (= R351), R334 (≠ H378), R334 (≠ H378)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 48, 178
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
28% identity, 45% coverage: 226:411/413 of query aligns to 183:369/377 of Q5L2C2
- R309 (= R351) binding
- 334:340 (vs. 376:382, 29% identical) binding
- R336 (≠ H378) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 180 binding
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
27% identity, 57% coverage: 177:411/413 of query aligns to 128:363/369 of O31616
- V174 (≠ A223) binding
- H244 (≠ Q294) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (= R351) binding
- 327:333 (vs. 376:382, 29% identical) binding
- R329 (≠ H378) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
27% identity, 57% coverage: 177:411/413 of query aligns to 128:363/364 of 3if9A
- binding flavin-adenine dinucleotide: P173 (vs. gap), V174 (≠ A223), S202 (≠ L251), G203 (= G252), W205 (= W254), F209 (≠ V258), G300 (= G349), R302 (= R351), H327 (= H376), F328 (≠ N377), R329 (≠ H378), N330 (≠ H379), G331 (= G380), I332 (≠ L381)
- binding glycolic acid: Y246 (= Y296), R302 (= R351), R329 (≠ H378)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
28% identity, 57% coverage: 177:411/413 of query aligns to 128:363/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (= Y296), R302 (= R351), R329 (≠ H378)
- binding flavin-adenine dinucleotide: V174 (≠ A223), S202 (≠ L251), G203 (= G252), W205 (= W254), F209 (≠ V258), G300 (= G349), R302 (= R351), H327 (= H376), R329 (≠ H378), N330 (≠ H379), G331 (= G380), I332 (≠ L381)
- binding phosphate ion: R254 (= R304)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49
- binding phosphate ion: 89
6pxsA Crystal structure of iminodiacetate oxidase (idaa) from chelativorans sp. Bnc1 (see paper)
29% identity, 47% coverage: 214:409/413 of query aligns to 165:365/370 of 6pxsA
- binding flavin-adenine dinucleotide: Y174 (≠ A223), A203 (≠ L251), W206 (= W254), I210 (≠ V258), Y250 (≠ L305), G305 (= G349), R307 (= R351), G333 (≠ N377), A334 (≠ H378), S335 (≠ H379), G336 (= G380), L337 (= L381), T338 (= T382)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 9, 10, 30, 32, 33, 36, 37, 38, 40, 41, 42, 43, 44
5i39A High resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence (see paper)
23% identity, 99% coverage: 4:412/413 of query aligns to 26:383/383 of 5i39A
- active site: F66 (vs. gap), Q69 (≠ N44), A70 (= A45), Q248 (= Q279), P267 (= P300)
- binding flavin-adenine dinucleotide: V30 (≠ L8), G31 (= G9), G33 (= G11), I34 (= I12), L35 (≠ V13), V53 (= V31), E54 (≠ D32), K55 (≠ R33), Q62 (≠ E39), S63 (≠ T40), F66 (vs. gap), Y67 (≠ F42), Q69 (≠ N44), A196 (= A223), A197 (≠ T224), G226 (≠ L251), G227 (= G252), W229 (= W254), Q248 (= Q279), Q250 (≠ T281), G321 (= G349), M323 (≠ R351), T348 (≠ N377), G349 (≠ H378), W350 (≠ H379), G351 (= G380), M352 (≠ L381), T353 (= T382)
7exsA Thermomicrobium roseum sarcosine oxidase mutant - s320r (see paper)
29% identity, 40% coverage: 229:394/413 of query aligns to 175:352/372 of 7exsA
- binding flavin-adenine dinucleotide: T196 (≠ A250), A197 (≠ L251), G198 (= G252), W200 (= W254), Y248 (≠ Q294), C307 (≠ G349), L308 (= L350), Y309 (≠ R351), G336 (≠ H378), H337 (= H379), G338 (= G380), F339 (≠ L381), K340 (≠ T382)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 9, 10, 11, 30, 31, 36, 39, 40, 41, 46, 47, 169
6j39A Crystal structure of cmis2 with inhibitor (see paper)
27% identity, 97% coverage: 13:412/413 of query aligns to 11:368/368 of 6j39A
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: M44 (≠ L47), P46 (≠ E49), N49 (≠ S52), R243 (≠ P288), Y252 (= Y296), Y267 (≠ I313), R308 (= R351), R334 (≠ H378), I335 (≠ H379)
- binding flavin-adenine dinucleotide: I11 (≠ V13), V29 (= V31), D30 (= D32), P31 (≠ R33), E32 (≠ R34), K36 (≠ E39), A37 (≠ T40), S38 (= S41), V40 (≠ G43), S41 (≠ N44), A42 (= A45), G43 (= G46), M44 (≠ L47), A174 (= A223), A203 (≠ L251), W206 (= W254), I228 (≠ H275), Y252 (= Y296), R308 (= R351), S333 (≠ N377), R334 (≠ H378), I335 (≠ H379), G336 (= G380), V337 (≠ L381), Q338 (≠ T382)
Sites not aligning to the query:
6j38A Crystal structure of cmis2 (see paper)
27% identity, 97% coverage: 13:412/413 of query aligns to 11:368/368 of 6j38A
- binding flavin-adenine dinucleotide: I11 (≠ V13), V29 (= V31), D30 (= D32), P31 (≠ R33), K36 (≠ E39), A37 (≠ T40), S38 (= S41), S41 (≠ N44), A42 (= A45), G43 (= G46), M44 (≠ L47), A174 (= A223), A203 (≠ L251), W206 (= W254), G226 (= G273), G306 (= G349), R308 (= R351), S333 (≠ N377), R334 (≠ H378), I335 (≠ H379), G336 (= G380), V337 (≠ L381), Q338 (≠ T382)
Sites not aligning to the query:
7fgpA Crystal structure of aureimonas altamirenisis flavin-containing opine dehydrogenase (fad-bound form)
25% identity, 100% coverage: 1:412/413 of query aligns to 1:373/379 of 7fgpA
- binding flavin-adenine dinucleotide: G9 (= G9), G11 (= G11), V12 (≠ I12), I13 (≠ V13), E32 (vs. gap), A33 (vs. gap), T40 (≠ S51), S41 (= S52), V43 (= V54), S44 (≠ P55), Y45 (= Y56), A46 (= A57), W47 (≠ F58), E97 (= E119), K179 (≠ D222), V180 (≠ A223), S210 (≠ L251), G211 (= G252), W213 (= W254), R314 (= R351), H339 (= H378), S340 (≠ H379), G341 (= G380), V342 (≠ L381), T343 (= T382)
7rdfA Crystal structure of pseudomonas aeruginosa d-arginine dehydrogenase y249f co-crystallized in the presence of d-arginine (see paper)
22% identity, 96% coverage: 1:395/413 of query aligns to 2:349/375 of 7rdfA
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{S})-5-[5-[(~{E})-4-carbamimidamidobut-2-enoyl]-7,8-dimethyl-2,4-bis(oxidanylidene)-1~{H}-benzo[g]pteridin-10-yl]-2,3,4-tris(oxidanyl)pentyl] hydrogen phosphate: I9 (≠ L8), G10 (= G9), G12 (= G11), I13 (= I12), A14 (≠ V13), L31 (= L30), E32 (≠ V31), R33 (≠ D32), H40 (≠ G43), S41 (≠ N44), T42 (≠ A45), R44 (≠ L47), S45 (≠ I48), A46 (≠ E49), H48 (≠ S51), Y53 (= Y56), E87 (≠ G128), E170 (≠ D222), A171 (= A223), A199 (≠ L251), G200 (= G252), W202 (= W254), R222 (≠ G273), F249 (≠ V297), G303 (= G349), R305 (= R351), Q330 (≠ H376), G331 (≠ N377), G332 (≠ H378), Y333 (≠ H379), G334 (= G380), I335 (≠ L381), Q336 (≠ T382)
- binding 6-hydroxy-flavin-adenine dinucleotide: I9 (≠ L8), G10 (= G9), G12 (= G11), I13 (= I12), A14 (≠ V13), E32 (≠ V31), R33 (≠ D32), H40 (≠ G43), S41 (≠ N44), T42 (≠ A45), S45 (≠ I48), A46 (≠ E49), H48 (≠ S51), E170 (≠ D222), A171 (= A223), A199 (≠ L251), G200 (= G252), W202 (= W254), R222 (≠ G273), G303 (= G349), R305 (= R351), Q330 (≠ H376), G331 (≠ N377), G332 (≠ H378), Y333 (≠ H379), G334 (= G380), I335 (≠ L381), Q336 (≠ T382)
6pldA Crystal structure of pseudomonas aeruginosa d-arginine dehydrogenase y249f variant with 6-oh-fad - green fraction (see paper)
22% identity, 96% coverage: 1:395/413 of query aligns to 2:349/375 of 6pldA
- binding 6-hydroxy-flavin-adenine dinucleotide: I9 (≠ L8), G10 (= G9), G12 (= G11), I13 (= I12), A14 (≠ V13), L31 (= L30), E32 (≠ V31), R33 (≠ D32), H40 (≠ G43), S41 (≠ N44), T42 (≠ A45), R44 (≠ L47), S45 (≠ I48), A46 (≠ E49), H48 (≠ S51), E170 (≠ D222), A171 (= A223), A199 (≠ L251), G200 (= G252), W202 (= W254), G303 (= G349), R305 (= R351), Q330 (≠ H376), G331 (≠ N377), G332 (≠ H378), Y333 (≠ H379), G334 (= G380), I335 (≠ L381), Q336 (≠ T382)
6p9dA Crystal structure of pseudomonas aeruginosa d-arginine dehydrogenase y249f variant with fad - yellow fraction (see paper)
22% identity, 96% coverage: 1:395/413 of query aligns to 2:349/375 of 6p9dA
- binding dihydroflavine-adenine dinucleotide: I9 (≠ L8), G10 (= G9), G12 (= G11), I13 (= I12), A14 (≠ V13), E32 (≠ V31), R33 (≠ D32), H40 (≠ G43), S41 (≠ N44), T42 (≠ A45), R44 (≠ L47), S45 (≠ I48), A46 (≠ E49), A47 (≠ S50), H48 (≠ S51), E170 (≠ D222), A171 (= A223), A199 (≠ L251), G200 (= G252), W202 (= W254), G303 (= G349), R305 (= R351), Q330 (≠ H376), G331 (≠ N377), G332 (≠ H378), Y333 (≠ H379), G334 (= G380), I335 (≠ L381), Q336 (≠ T382)
3sm8A Crystal structure of pseudomonas aeruginosa d-arginine dehydrogenase in complex with an (n5) flavin adduct (see paper)
22% identity, 96% coverage: 1:395/413 of query aligns to 8:355/381 of 3sm8A
- binding [(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methyl (2R,3S,4S)-5-[7,8-dimethyl-5-(3-methylbutanoyl)-2,4-dioxo-1,3,4,5-tetrahydrobenzo[g]pteridin-10(2H)-yl]-2,3,4-trihydroxypentyl dihydrogen diphosphate: I15 (≠ L8), G16 (= G9), G18 (= G11), I19 (= I12), A20 (≠ V13), L37 (= L30), E38 (≠ V31), R39 (≠ D32), H46 (≠ G43), S47 (≠ N44), T48 (≠ A45), R50 (≠ L47), S51 (≠ I48), A52 (≠ E49), H54 (≠ S51), Y59 (= Y56), E176 (≠ D222), A177 (= A223), A205 (≠ L251), G206 (= G252), W208 (= W254), I212 (≠ V258), R228 (≠ G273), M246 (= M284), Y255 (≠ V297), G309 (= G349), R311 (= R351), Q336 (≠ H376), G337 (≠ N377), G338 (≠ H378), Y339 (≠ H379), G340 (= G380), I341 (≠ L381), Q342 (≠ T382)
3nyfA Crystal structure of pseudomonas aeruginosa d-arginine dehydrogenase in complex with imino-histidine (see paper)
22% identity, 96% coverage: 1:395/413 of query aligns to 8:355/381 of 3nyfA
- binding flavin-adenine dinucleotide: I15 (≠ L8), G16 (= G9), G18 (= G11), I19 (= I12), A20 (≠ V13), L37 (= L30), E38 (≠ V31), R39 (≠ D32), H46 (≠ G43), S47 (≠ N44), T48 (≠ A45), R50 (≠ L47), S51 (≠ I48), A52 (≠ E49), H54 (≠ S51), E176 (≠ D222), A177 (= A223), A205 (≠ L251), G206 (= G252), W208 (= W254), I212 (≠ V258), G309 (= G349), R311 (= R351), Q336 (≠ H376), G337 (≠ N377), G338 (≠ H378), Y339 (≠ H379), G340 (= G380), I341 (≠ L381), Q342 (≠ T382)
- binding (2Z)-3-(1H-imidazol-5-yl)-2-iminopropanoic acid: H54 (≠ S51), T56 (≠ V53), Y59 (= Y56), E93 (≠ G128), R228 (≠ G273), M246 (= M284), Y255 (≠ V297), R311 (= R351), G338 (≠ H378)
3nycA Crystal structure of pseudomonas aeruginosa d-arginine dehydrogenase (see paper)
22% identity, 96% coverage: 1:395/413 of query aligns to 8:355/381 of 3nycA
- binding flavin-adenine dinucleotide: I15 (≠ L8), G16 (= G9), G18 (= G11), I19 (= I12), A20 (≠ V13), L37 (= L30), E38 (≠ V31), R39 (≠ D32), H46 (≠ G43), S47 (≠ N44), T48 (≠ A45), R50 (≠ L47), S51 (≠ I48), A53 (≠ S50), H54 (≠ S51), E176 (≠ D222), A177 (= A223), A205 (≠ L251), G206 (= G252), W208 (= W254), I212 (≠ V258), G309 (= G349), R311 (= R351), Q336 (≠ H376), G337 (≠ N377), G338 (≠ H378), Y339 (≠ H379), G340 (= G380), I341 (≠ L381), Q342 (≠ T382)
- binding (2E)-5-[(diaminomethylidene)amino]-2-iminopentanoic acid: Y59 (= Y56), E93 (≠ G128), R228 (≠ G273), M246 (= M284), E252 (≠ Q294), Y255 (≠ V297), R311 (= R351), G338 (≠ H378)
Query Sequence
>BPHYT_RS10270 FitnessBrowser__BFirm:BPHYT_RS10270
MDFDVIVLGAGIVGVSSALHLQDRGRRVALVDRRGPGEETSFGNAGLIESSSVVPYAFPR
NLGTLLRYARNRSTDLYWDYRALPSFAGWLARFWWESSPERLMAAAHDMLPLMRHSVAEH
DVLIARAGLEQLASDKGWIEAFRTPAEFSRQSAAAEVTANTYGLRVTTLDAAALAAREPG
VAEGFCGALHWQDPKSIVNPGALTQGYARLFEESGGALLTGDATTLKAEGGAWTVQTSSG
RISAKEVVVALGPWSDRVFAPLGYRIPLRAKRGYHMHYQPTQPMLSTPLVDSQQGYVVAP
MQGRLRLTTGVEIARREAAPTGVQLERAERTARPTFGLGARLDEHPWLGLRPCTPDMRPV
IGPAPRHRGLWFAFGHNHHGLTLGPVTGRLLAEMMTGAEPFVDARPFRPERFR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory