Comparing BPHYT_RS10700 FitnessBrowser__BFirm:BPHYT_RS10700 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
Q01468 2-hydroxymuconate tautomerase; 4-oxalocrotonate tautomerase; 4-OT; EC 5.3.2.6 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
39% identity, 44% coverage: 72:127/127 of query aligns to 8:63/63 of Q01468
Sites not aligning to the query:
5tigA Crystal structure of 4-oxalocrotonate tautomerase inactivated by brhpd (see paper)
39% identity, 44% coverage: 72:127/127 of query aligns to 7:62/62 of 5tigA
Sites not aligning to the query:
1bjpA Crystal structure of 4-oxalocrotonate tautomerase inactivated by 2- oxo-3-pentynoate at 2.4 angstroms resolution (see paper)
39% identity, 44% coverage: 72:127/127 of query aligns to 7:62/62 of 1bjpA
Sites not aligning to the query:
6ghwC Substituting the prolines of 4-oxalocrotonate tautomerase with non- canonical analogue (2s)-3,4-dehydroproline (see paper)
41% identity, 40% coverage: 72:122/127 of query aligns to 7:57/57 of 6ghwC
Sites not aligning to the query:
6bgnA Crystal structure of 4-oxalocrotonate tautomerase after incubation with 5-fluoro-2-hydroxy-2,4-pentadienoate (see paper)
41% identity, 40% coverage: 72:122/127 of query aligns to 7:57/59 of 6bgnA
Sites not aligning to the query:
>BPHYT_RS10700 FitnessBrowser__BFirm:BPHYT_RS10700
MPTLEVYLPDGHWPARKAQLIAALTKATVTAIGAPAESVRILLSELPSHDFGLGGVSNAN
VRAPLLTIVAILIAGRTPAQKEALIAALSKTGADLLDTPLDAARVMIKDIPNTDFGIGGQ
TAKSLGR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory