SitesBLAST
Comparing BPHYT_RS10825 BPHYT_RS10825 (2Fe-2S)-binding protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1t3qA Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
53% identity, 88% coverage: 12:165/176 of query aligns to 6:161/162 of 1t3qA
- binding fe2/s2 (inorganic) cluster: I40 (≠ V46), C42 (= C48), E43 (= E49), G45 (= G51), C47 (= C53), G48 (= G54), C50 (= C56), R60 (= R66), C62 (= C68), C101 (= C107), G102 (= G108), C104 (= C110), C136 (= C142), C138 (= C144)
- binding pterin cytosine dinucleotide: Q100 (= Q106), C138 (= C144)
1ffuD Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
50% identity, 88% coverage: 9:163/176 of query aligns to 2:155/156 of 1ffuD
- binding fe2/s2 (inorganic) cluster: C41 (= C48), S44 (≠ G51), H45 (≠ V52), C46 (= C53), G47 (= G54), C49 (= C56), C61 (= C68), C100 (= C107), G101 (= G108), C103 (= C110), C135 (= C142), C137 (= C144)
1ffvA Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
50% identity, 88% coverage: 9:163/176 of query aligns to 1:154/155 of 1ffvA
- binding fe2/s2 (inorganic) cluster: I38 (≠ V46), C40 (= C48), S43 (≠ G51), C45 (= C53), G46 (= G54), C48 (= C56), C60 (= C68), C99 (= C107), G100 (= G108), C102 (= C110), C134 (= C142), C136 (= C144)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q98 (= Q106), C136 (= C144)
4zohC Crystal structure of glyceraldehyde oxidoreductase (see paper)
46% identity, 91% coverage: 1:160/176 of query aligns to 1:159/161 of 4zohC
- binding fe2/s2 (inorganic) cluster: C47 (= C48), S50 (≠ G51), C52 (= C53), G53 (= G54), C55 (= C56), C67 (= C68), C106 (= C107), G107 (= G108), C109 (= C110), C141 (= C142), C143 (= C144)
- binding pterin cytosine dinucleotide: Q105 (= Q106), C143 (= C144)
P19921 Carbon monoxide dehydrogenase small chain; CO dehydrogenase subunit S; CO-DH S; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
49% identity, 85% coverage: 12:160/176 of query aligns to 6:155/166 of P19921
- C42 (= C48) binding
- C47 (= C53) binding
- C50 (= C56) binding
- C62 (= C68) binding
- C102 (= C107) binding
- C105 (= C110) binding
- C137 (= C142) binding
- C139 (= C144) binding
1n5wA Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
49% identity, 85% coverage: 12:160/176 of query aligns to 4:153/161 of 1n5wA
- binding flavin-adenine dinucleotide: S43 (≠ G51), H44 (≠ V52)
- binding fe2/s2 (inorganic) cluster: I38 (≠ V46), G39 (= G47), C40 (= C48), S43 (≠ G51), C45 (= C53), G46 (= G54), C48 (= C56), C60 (= C68), C100 (= C107), G101 (= G108), C103 (= C110), C135 (= C142), C137 (= C144)
1n5wD Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
49% identity, 85% coverage: 12:160/176 of query aligns to 4:153/158 of 1n5wD
- binding flavin-adenine dinucleotide: S43 (≠ G51), H44 (≠ V52)
- binding fe2/s2 (inorganic) cluster: C40 (= C48), S43 (≠ G51), C45 (= C53), G46 (= G54), C48 (= C56), C60 (= C68), C100 (= C107), G101 (= G108), C103 (= C110), C135 (= C142), C137 (= C144)
- binding pterin cytosine dinucleotide: Q99 (= Q106), C137 (= C144)
7dqxC Crystal structure of xanthine dehydrogenase family protein
51% identity, 82% coverage: 12:156/176 of query aligns to 6:151/160 of 7dqxC
- binding fe2/s2 (inorganic) cluster: C42 (= C48), G45 (= G51), V46 (= V52), C47 (= C53), C50 (= C56), R60 (= R66), C62 (= C68), Q100 (= Q106), C101 (= C107), C104 (= C110), C137 (= C142), C139 (= C144)
- binding pterin cytosine dinucleotide: Q100 (= Q106), C139 (= C144)
4usaA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with trans-cinnamaldehyde (see paper)
46% identity, 83% coverage: 14:159/176 of query aligns to 6:154/907 of 4usaA
- binding fe2/s2 (inorganic) cluster: V38 (= V46), C40 (= C48), E41 (= E49), G43 (= G51), C45 (= C53), G46 (= G54), C48 (= C56), R58 (= R66), C60 (= C68), C100 (= C107), G101 (= G108), C103 (= C110), C137 (= C142), C139 (= C144)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q106), C139 (= C144)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 531, 532, 535, 539
- binding hydrocinnamic acid: 255, 425, 494, 497, 535, 626
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us9A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with 3- phenylpropionaldehyde (see paper)
46% identity, 83% coverage: 14:159/176 of query aligns to 6:154/907 of 4us9A
- binding fe2/s2 (inorganic) cluster: V38 (= V46), C40 (= C48), E41 (= E49), G43 (= G51), C45 (= C53), G46 (= G54), C48 (= C56), R58 (= R66), C60 (= C68), C100 (= C107), G101 (= G108), C103 (= C110), C137 (= C142), C139 (= C144)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q106), C139 (= C144)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding 3-phenylpropanal: 255, 257, 258, 752
- binding bicarbonate ion: 460, 498, 531, 532, 535, 539, 890, 892
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us8A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with benzaldehyde (see paper)
46% identity, 83% coverage: 14:159/176 of query aligns to 6:154/907 of 4us8A
- binding fe2/s2 (inorganic) cluster: V38 (= V46), C40 (= C48), E41 (= E49), G43 (= G51), C45 (= C53), G46 (= G54), C48 (= C56), R58 (= R66), C60 (= C68), C100 (= C107), G101 (= G108), C103 (= C110), C137 (= C142), C139 (= C144)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q106), C139 (= C144)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 498, 531, 532, 535, 539
- binding benzaldehyde: 255, 255, 394, 425, 425, 425, 425, 497, 497, 501, 531, 535, 535, 626, 626, 626, 694, 696, 697
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4c7yA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide (see paper)
46% identity, 83% coverage: 14:159/176 of query aligns to 6:154/907 of 4c7yA
- binding fe2/s2 (inorganic) cluster: C40 (= C48), E41 (= E49), G43 (= G51), C45 (= C53), G46 (= G54), C48 (= C56), R58 (= R66), C60 (= C68), C100 (= C107), G101 (= G108), C103 (= C110), C137 (= C142), C139 (= C144)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q106), C139 (= C144)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 498, 531, 535, 539
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
- binding hydrogen peroxide: 696, 697, 869
3fc4A Ethylene glycol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
46% identity, 83% coverage: 14:159/176 of query aligns to 6:154/907 of 3fc4A
- binding fe2/s2 (inorganic) cluster: V38 (= V46), C40 (= C48), E41 (= E49), G43 (= G51), C45 (= C53), G46 (= G54), C48 (= C56), R58 (= R66), C60 (= C68), C100 (= C107), G101 (= G108), C103 (= C110), C137 (= C142), C139 (= C144)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q106), C139 (= C144)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding 1,2-ethanediol: 535, 622, 696, 697, 869
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
3fahA Glycerol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
46% identity, 83% coverage: 14:159/176 of query aligns to 6:154/907 of 3fahA
- binding fe2/s2 (inorganic) cluster: V38 (= V46), C40 (= C48), E41 (= E49), G43 (= G51), C45 (= C53), G46 (= G54), C48 (= C56), R58 (= R66), C60 (= C68), C100 (= C107), G101 (= G108), C103 (= C110), C137 (= C142), C139 (= C144)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q106), C139 (= C144)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding glycerol: 416, 535, 622, 683, 696, 697, 869, 884, 889, 890, 892
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
1sijA Crystal structure of the aldehyde dehydrogenase (a.K.A. Aor or mop) of desulfovibrio gigas covalently bound to [aso3]- (see paper)
46% identity, 83% coverage: 14:159/176 of query aligns to 6:154/907 of 1sijA
- binding fe2/s2 (inorganic) cluster: V38 (= V46), C40 (= C48), E41 (= E49), G43 (= G51), C45 (= C53), G46 (= G54), C48 (= C56), R58 (= R66), C60 (= C68), Q99 (= Q106), C100 (= C107), G101 (= G108), C103 (= C110), C137 (= C142), C139 (= C144)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q106), C139 (= C144)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding arsenite: 535, 696, 697, 869
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 653, 654, 655, 656, 695, 696, 698, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
Q46509 Aldehyde oxidoreductase; Molybdenum iron sulfur protein; EC 1.2.99.7 from Megalodesulfovibrio gigas (Desulfovibrio gigas) (see paper)
46% identity, 83% coverage: 14:159/176 of query aligns to 6:154/907 of Q46509
- C40 (= C48) binding
- C45 (= C53) binding
- C48 (= C56) binding
- C60 (= C68) binding
- C100 (= C107) binding
- C103 (= C110) binding
- C137 (= C142) binding
- C139 (= C144) binding
1sb3C Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
44% identity, 87% coverage: 9:161/176 of query aligns to 2:154/161 of 1sb3C
- binding fe2/s2 (inorganic) cluster: Q39 (≠ V46), C41 (= C48), G44 (= G51), C46 (= C53), G47 (= G54), C49 (= C56), C61 (= C68), C100 (= C107), G101 (= G108), C103 (= C110), C135 (= C142), C137 (= C144)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q106), C137 (= C144)
3hrdD Crystal structure of nicotinate dehydrogenase (see paper)
45% identity, 81% coverage: 12:154/176 of query aligns to 6:148/160 of 3hrdD
- binding flavin-adenine dinucleotide: E44 (≠ H50), G45 (= G51), E46 (≠ V52)
- binding fe2/s2 (inorganic) cluster: E40 (≠ V46), C42 (= C48), S43 (≠ E49), G45 (= G51), C47 (= C53), G48 (= G54), C50 (= C56), C62 (= C68), Q100 (= Q106), C101 (= C107), G102 (= G108), C104 (= C110), C136 (= C142), C138 (= C144)
- binding pterin cytosine dinucleotide: Q100 (= Q106), C138 (= C144)
Q0QLF3 Nicotinate dehydrogenase small FeS subunit; NDH; Nicotinic acid hydroxylase small FeS subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
45% identity, 81% coverage: 12:154/176 of query aligns to 6:148/157 of Q0QLF3
- C42 (= C48) binding
- C47 (= C53) binding
- C50 (= C56) binding
- C62 (= C68) binding
- C101 (= C107) binding
- C104 (= C110) binding
- C136 (= C142) binding
- C138 (= C144) binding
1dgjA Crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 (see paper)
43% identity, 92% coverage: 10:171/176 of query aligns to 2:165/906 of 1dgjA
- binding fe2/s2 (inorganic) cluster: V38 (= V46), G39 (= G47), C40 (= C48), G41 (≠ E49), G43 (= G51), Q44 (≠ V52), C45 (= C53), G46 (= G54), C48 (= C56), R58 (= R66), C60 (= C68), C100 (= C107), G101 (= G108), C103 (= C110), C137 (= C142), C139 (= C144)
- binding pterin cytosine dinucleotide: Q99 (= Q106), C139 (= C144)
Sites not aligning to the query:
- active site: 391, 427, 503, 507, 535, 869, 870
- binding molybdenum (iv)oxide: 424, 535, 698, 869
- binding pterin cytosine dinucleotide: 423, 424, 535, 652, 655, 656, 657, 658, 697, 698, 700, 702, 703, 799, 800, 803, 804, 807, 865, 866, 867, 868, 869
Query Sequence
>BPHYT_RS10825 BPHYT_RS10825 (2Fe-2S)-binding protein
MHVMRQGERQCVTLTLNGRERSGYCEPRELLSDFIRQELGATGTHVGCEHGVCGACTVHV
DGVAGRSCLMLAVQADGRRIDTVEGLAPDMQLGDLQQAFQRHHALQCGFCTAGILMSCAD
YLQRVPDPSEAQVRDMLSGHLCRCTGYTPIVAAVLDVAARRRQGEAASETVEAAHA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory