Comparing BPHYT_RS10930 FitnessBrowser__BFirm:BPHYT_RS10930 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
8gxkB Pseudomonas jinjuensis n-acetyltransferase (see paper)
43% identity, 71% coverage: 58:198/199 of query aligns to 53:187/188 of 8gxkB
Sites not aligning to the query:
1yreB Hypothetical protein pa3270 from pseudomonas aeruginosa in complex with coa
38% identity, 77% coverage: 45:197/199 of query aligns to 37:186/187 of 1yreB
8gxfB Pseudomonas flexibilis gcn5 family acetyltransferase (see paper)
36% identity, 95% coverage: 10:198/199 of query aligns to 4:187/187 of 8gxfB
6c37A Mycobacterium smegmatis rimj in complex with coa-disulfide
28% identity, 74% coverage: 38:185/199 of query aligns to 51:191/209 of 6c37A
Sites not aligning to the query:
6c32A Mycobacterium smegmatis rimj with accoa
28% identity, 74% coverage: 38:185/199 of query aligns to 51:191/209 of 6c32A
Sites not aligning to the query:
>BPHYT_RS10930 FitnessBrowser__BFirm:BPHYT_RS10930
MNDIDRRLMQPTLTGKTVELQPLQREHAQGLLDAAAEGQLWNMKLTVVPGAGTVDGYIAT
ALEGRAAGTVMPFVIVRRDTGALVGSTRFWKIDRVNRKLEIGHTWLGESVQRSAVNTEAK
YLLLCHAFETMQCVRVQFTTDELNEKSRAAILRIGAKQEGVVRHERIMPDGRKRNSVRFS
IIDEEWSEVKAMLEAKLAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory