Comparing BPHYT_RS10980 FitnessBrowser__BFirm:BPHYT_RS10980 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
B5R541 D-galactonate dehydratase family member SEN1436; D-gluconate dehydratase; EC 4.2.1.-; EC 4.2.1.39 from Salmonella enteritidis PT4 (strain P125109) (see paper)
53% identity, 99% coverage: 5:415/415 of query aligns to 8:419/419 of B5R541
3twbC Crystal structure of gluconate dehydratase (target efi-501679) from salmonella enterica subsp. Enterica serovar enteritidis str. P125109 complexed with magnesium and gluconic acid
53% identity, 99% coverage: 5:415/415 of query aligns to 6:417/417 of 3twbC
4ihcB Crystal structure of probable mannonate dehydratase dd703_0947 (target efi-502222) from dickeya dadantii ech703
53% identity, 99% coverage: 5:415/415 of query aligns to 4:395/395 of 4ihcB
C6CBG9 D-galactonate dehydratase family member Dd703_0947; D-gluconate dehydratase; D-mannonate dehydratase; EC 4.2.1.-; EC 4.2.1.39; EC 4.2.1.8 from Musicola paradisiaca (strain Ech703) (Dickeya paradisiaca) (Dickeya dadantii) (see paper)
52% identity, 99% coverage: 5:415/415 of query aligns to 6:417/417 of C6CBG9
D4GJ14 D-galactonate dehydratase family member RspA; D-gluconate dehydratase; Starvation sensing protein RspA homolog; EC 4.2.1.-; EC 4.2.1.39 from Pantoea ananatis (strain LMG 20103) (see paper)
52% identity, 99% coverage: 4:415/415 of query aligns to 5:417/417 of D4GJ14
3t6cA Crystal structure of an enolase from pantoea ananatis (efi target efi- 501676) with bound d-gluconate and mg
52% identity, 99% coverage: 4:415/415 of query aligns to 3:415/415 of 3t6cA
A6M2W4 D-galactonate dehydratase family member Cbei_4837 from Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) (Clostridium acetobutylicum) (see paper)
52% identity, 100% coverage: 3:415/415 of query aligns to 4:399/399 of A6M2W4
3gy1B Crystal structure of putative mandelate racemase/muconate lactonizing protein from clostridium beijerinckii ncimb 8052
50% identity, 99% coverage: 3:414/415 of query aligns to 5:384/388 of 3gy1B
4hnlA Crystal structure of enolase egbg_01401 (target efi-502226) from enterococcus gallinarum eg2
49% identity, 100% coverage: 3:415/415 of query aligns to 6:401/401 of 4hnlA
C8ZZN2 D-galactonate dehydratase family member EGBG_01401 from Enterococcus gallinarum (strain EG2) (see paper)
49% identity, 100% coverage: 3:415/415 of query aligns to 4:399/399 of C8ZZN2
3tjiA Crystal structure of an enolase from enterobacter sp. 638 (efi target efi-501662) with bound mg
48% identity, 100% coverage: 3:415/415 of query aligns to 4:399/399 of 3tjiA
A4W7D6 D-galactonate dehydratase family member Ent638_0932 from Enterobacter sp. (strain 638) (see paper)
48% identity, 100% coverage: 3:415/415 of query aligns to 4:399/399 of A4W7D6
4girB Crystal structure of an enolase family member from vibrio harveyi (efi-target 501692) with homology to mannonate dehydratase, with mg, ethylene glycol and sulfate bound (ordered loops, space group p41212)
47% identity, 99% coverage: 5:415/415 of query aligns to 18:411/411 of 4girB
D0X4R4 D-galactonate dehydratase family member VME_00770 from Vibrio harveyi (strain 1DA3) (see paper)
47% identity, 99% coverage: 5:415/415 of query aligns to 6:399/399 of D0X4R4
3r25B Crystal structure of enolase superfamily member from vibrionales bacterium complexed with mg and glycerol in the active site
46% identity, 100% coverage: 3:415/415 of query aligns to 4:399/399 of 3r25B
A5KUH4 D-galactonate dehydratase family member VSWAT3_13707 from Vibrionales bacterium (strain SWAT-3) (see paper)
46% identity, 100% coverage: 3:415/415 of query aligns to 4:399/399 of A5KUH4
3sbfA Crystal structure of the mutant p311a of enolase superfamily member from vibrionales bacterium complexed with mg and d-arabinonate
46% identity, 100% coverage: 3:415/415 of query aligns to 2:397/397 of 3sbfA
Q8FHC7 D-galactonate dehydratase family member RspA; D-mannonate dehydratase; Starvation sensing protein RspA homolog; EC 4.2.1.-; EC 4.2.1.8 from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) (see paper)
43% identity, 98% coverage: 5:412/415 of query aligns to 14:412/415 of Q8FHC7
4il2B Crystal structure of d-mannonate dehydratase (rspa) from e. Coli cft073 (efi target efi-501585)
43% identity, 98% coverage: 5:412/415 of query aligns to 3:401/404 of 4il2B
Sites not aligning to the query:
C6D9S0 D-galactonate dehydratase family member PC1_0802; D-mannonate dehydratase; EC 4.2.1.-; EC 4.2.1.8 from Pectobacterium carotovorum subsp. carotovorum (strain PC1) (see paper)
42% identity, 98% coverage: 5:412/415 of query aligns to 3:401/404 of C6D9S0
>BPHYT_RS10980 FitnessBrowser__BFirm:BPHYT_RS10980
MATLITDVKVILTAPEGINLIVVKVETNQPGLYGLGCSTFAYRHVAVQCLIEEYLRPLLI
GRDADAIEELWQLMHQNAYWRNGPIENNAISGVDMALWDIKGKLANMPLYQLFGGKCREG
VPIYRHADGRDLNELCENIQKYREQGITHIRCQSGGYGGGGFGKAPASAPHGSADGVYLD
SRKYMRDTLKLFDGIRSKIGFDVALCHDVHERLKPVEAIRFACELERYELFFLEDAIALE
EGEWMRQLRAKTTTPLAQGELFNNPYEWRFLITERLIDFIRVHLSQIGGITAARKLQIFA
EQFGVRTAWHGPGDMSPLAHAANIHIDLAARNFGVQEWSGTEPPNFVIQDLKGPRAALLD
VFPGLPEFRQGYVYANDKPGLGVDIDEAEAAKYPCENSVTTWTQTRLKDGTLQTP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory