Comparing BPHYT_RS11030 FitnessBrowser__BFirm:BPHYT_RS11030 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
8hkbA Tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d (see paper)
28% identity, 76% coverage: 38:290/332 of query aligns to 5:253/302 of 8hkbA
5okuA R. Palustris rpa4515 with adipate (see paper)
27% identity, 73% coverage: 34:275/332 of query aligns to 3:240/299 of 5okuA
5oeiA R. Palustris rpa4515 with oxoadipate (see paper)
27% identity, 73% coverage: 34:275/332 of query aligns to 3:240/299 of 5oeiA
7ndrD Crystal structure of tphc in an open conformation (see paper)
26% identity, 66% coverage: 35:252/332 of query aligns to 2:214/293 of 7ndrD
7ndsA Crystal structure of tphc in a closed conformation (see paper)
26% identity, 65% coverage: 36:252/332 of query aligns to 3:214/294 of 7ndsA
Sites not aligning to the query:
2dvzA Structure of a periplasmic transporter (see paper)
26% identity, 73% coverage: 34:275/332 of query aligns to 3:241/300 of 2dvzA
>BPHYT_RS11030 FitnessBrowser__BFirm:BPHYT_RS11030
MKRRLETSSVARGICVALLAACATLANAADAWQPRRPIEIVVPSAPGGGLDLVARTLQSV
IQQEKLSAKPVTVINRPGGGGTVSIAYINSHEADGHFVTVQALPLITNRITGLSTVGIDD
VTPLAVFVTEQVVFSVPGNSPIKSGSDLVQMLKKDPTSVTLGVSSSPGGQSHDAAALVMK
GAGQDPKKMKVVFFDSGGEALTALMGGHVTASATPAGVVLGPSKSGSVRMIAIPGGARQG
GELANVPTWKEQGINVDFTTWRVLVGPKNMTPAEIAWWDNVLQKATASPEWAVAVKRNLW
TADYKNSTQTRAFLQGERNRLTPLLGELGIAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory