SitesBLAST
Comparing BPHYT_RS11800 FitnessBrowser__BFirm:BPHYT_RS11800 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
P07117 Sodium/proline symporter; Proline carrier; Proline permease; Propionate transporter from Escherichia coli (strain K12) (see 4 papers)
24% identity, 91% coverage: 23:501/528 of query aligns to 18:470/502 of P07117
- R257 (= R260) mutation to C: Sodium-independent binding affinity for proline.
- C281 (≠ F284) mutation to S: Does not affect proline uptake activity. Confers resistance to N-ethylmaleimide. Na(+)-dependent proline binding activity is similar to wild-type carrier.
- C344 (≠ G352) mutation to S: Small decrease in proline uptake activity. Confers resistance to N-ethylmaleimide. Exhibits low Na(+)-dependent proline binding.
- C349 (≠ S357) mutation to S: Does not affect proline uptake activity. Sensitive to N-ethylmaleimide. Na(+)-dependent proline binding activity is similar to wild-type carrier.
- R376 (≠ K385) mutation R->E,Q: No change in activity.; mutation to K: Loss of activity.
Q9GZV3 High affinity choline transporter 1; hCHT1; Hemicholinium-3-sensitive choline transporter; CHT; Solute carrier family 5 member 7 from Homo sapiens (Human) (see 5 papers)
22% identity, 74% coverage: 12:404/528 of query aligns to 8:401/580 of Q9GZV3
- D48 (≠ N45) to G: in CMS20; decreased choline transmembrane transporter activity; no effect on localization at plasma membrane; dbSNP:rs886039768
- G65 (≠ A62) to E: in CMS20; loss of choline transmembrane transporter activity; no effect on localization at plasma membrane; dbSNP:rs886039765
- I89 (≠ V84) to V: 40% reduction in choline transmembrane transporter activity; found in 0.06 of Ashkenazi Jews; dbSNP:rs1013940; mutation to A: Decreased choline transmembrane transporter activity, only 20% of wild-type choline uptake activity.
- P105 (= P100) to S: in CMS20; decreased choline transmembrane transporter activity; no effect on localization at plasma membrane; dbSNP:rs886039766
- Y111 (≠ K106) to H: in CMS20; no effect on localization at plasma membrane
- Y175 (= Y171) to C: in CMS20; uncertain significance; dbSNP:rs1331713195
- I291 (≠ M288) to T: in CMS20; uncertain significance; dbSNP:rs375397889
- V344 (≠ I353) to L: in CMS20; uncertain significance
- R361 (≠ H363) to Q: in CMS20; decreased choline transmembrane transporter activity; no effect on localization at plasma membrane; dbSNP:rs147656110
Sites not aligning to the query:
- 418 F → V: in CMS20; uncertain significance
- 446 R → G: in CMS20; decreased choline transmembrane transporter activity; no effect on localization at plasma membrane
- 451 E→Q: Decreased choline transmembrane transporter activity, only 5% of wild-type choline uptake activity.
- 527:532 Dileucine-like motif
- 530 I→A: No change in protein internalization. No change in choline transmembrane transporter activity.
- 531 L→A: Loss of protein internalization to vesicular structures in neurons. Increased choline transmembrane transporter activity.
- 531:532 LV→AA: Decreased protein internalization; when associated with V-538. Increased choline transmembrane transporter activity; when associated with V-538.
- 532 V→A: Decreased protein internalization. Increased choline transmembrane transporter activity.
- 538 K→V: Decreased protein internalization; when associated with 531-L-V-532. Increased choline transmembrane transporter activity; when associated with 531-L-V-532.
Query Sequence
>BPHYT_RS11800 FitnessBrowser__BFirm:BPHYT_RS11800
MNNLISHGGLRIIAFVGFIGLSLVLTGWSARRSRGTSGFFVAGRNLSPFQNGLALAGDFM
SAGSFLGVTGLVSLFGFDGIVYQVGFIAGWIMIMLIVAEPVRNCGKYTLSDVVALRLRSR
GVRAATSVSSLITSLAYLLAQLVGGGALASLLLPIGTNAAIVLIGILMIAYVLFGGMVAA
TYVQIVKAVLVWTAGAVLVLLALAHFSFDVGALFNKARLSSLHPAQYFVPGGYFKDPLDT
LSLTLALALGTAGLPHVMTRFYTVPSAVAARKSAKIGLIVMTSFAVMMILLGFSATAIVG
PAAILATHSSGNSAITLLATTLGGGAGSAGGELLLACVSAIAFATILAVVSGIMISSAST
ISHDIFGQLFSASRDKERRQVVIAKIATIVFGIAAMGLALLVKTFNVAFLVGLAFAIAAS
ANLPVILFSMYWRRFTDRGAVAAVLAGTLSSIGLVLLGPAVIGAKGIIFKDSTPPFWLSN
PGLFSIPVGFIAGWIGSVTTSQNAADTSFDAQQLRMLSGLGAEAASEH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory