SitesBLAST
Comparing BPHYT_RS11930 FitnessBrowser__BFirm:BPHYT_RS11930 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8dt1C Crystal structure of a putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 in complex with NAD
71% identity, 99% coverage: 3:260/260 of query aligns to 2:259/259 of 8dt1C
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), S14 (= S15), G15 (= G16), I16 (= I17), D35 (= D36), L36 (= L37), M60 (= M61), V62 (= V63), N88 (= N89), A89 (= A90), M139 (= M140), Y154 (= Y155), K158 (= K159), P184 (= P185), G185 (= G186), F186 (= F187), V187 (= V188), T189 (= T190)
6zzpA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with NAD+ and 3-oxovalerate (see paper)
65% identity, 99% coverage: 3:260/260 of query aligns to 8:265/265 of 6zzpA
- binding nicotinamide-adenine-dinucleotide: G17 (= G12), S20 (= S15), G21 (= G16), I22 (= I17), D41 (= D36), I42 (≠ L37), M66 (= M61), D67 (= D62), V68 (= V63), N94 (= N89), A95 (= A90), G96 (= G91), M145 (= M140), S147 (= S142), Y160 (= Y155), K164 (= K159), P190 (= P185), F192 (= F187), V193 (= V188), T195 (= T190), L197 (= L192), V198 (= V193)
- binding 3-oxidanylidenepentanoic acid: Q98 (= Q93), S147 (= S142), H149 (= H144), K157 (= K152), Y160 (= Y155), F192 (= F187), Q201 (= Q196)
6zzoC Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with NAD+ and acetoacetate (see paper)
65% identity, 99% coverage: 3:260/260 of query aligns to 8:265/265 of 6zzoC
- binding acetoacetic acid: Q98 (= Q93), H149 (= H144), K157 (= K152), F192 (= F187), Q201 (= Q196)
- binding nicotinamide-adenine-dinucleotide: G17 (= G12), S20 (= S15), G21 (= G16), I22 (= I17), D41 (= D36), I42 (≠ L37), M66 (= M61), D67 (= D62), V68 (= V63), N94 (= N89), A95 (= A90), G96 (= G91), M145 (= M140), Y160 (= Y155), K164 (= K159), P190 (= P185), F192 (= F187), V193 (= V188), T195 (= T190), L197 (= L192), V198 (= V193)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
38% identity, 99% coverage: 3:260/260 of query aligns to 5:261/261 of 6zzsD
- active site: G18 (= G16), S143 (= S142), Y156 (= Y155)
- binding nicotinamide-adenine-dinucleotide: G14 (= G12), S17 (= S15), I19 (= I17), D38 (= D36), M39 (≠ L37), D64 (= D62), V65 (= V63), N91 (= N89), A92 (= A90), G93 (= G91), M141 (= M140), A142 (≠ G141), S143 (= S142), Y156 (= Y155), K160 (= K159), P186 (= P185), G187 (= G186), V189 (= V188), T191 (= T190), L193 (= L192)
- binding 3-oxidanylidenepentanoic acid: Q95 (= Q93), S143 (= S142), N145 (≠ H144), K153 (= K152), Y156 (= Y155), Q197 (= Q196)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
38% identity, 99% coverage: 3:260/260 of query aligns to 4:260/260 of 6zzqA
- active site: G17 (= G16), S142 (= S142), Y155 (= Y155)
- binding acetoacetic acid: Q94 (= Q93), S142 (= S142), K152 (= K152), Y155 (= Y155), Q196 (= Q196)
- binding nicotinamide-adenine-dinucleotide: G13 (= G12), S16 (= S15), G17 (= G16), I18 (= I17), D37 (= D36), M38 (≠ L37), D63 (= D62), V64 (= V63), N90 (= N89), A91 (= A90), G92 (= G91), M140 (= M140), A141 (≠ G141), S142 (= S142), Y155 (= Y155), K159 (= K159), Y187 (≠ F187), V188 (= V188), T190 (= T190)
2ztlA Closed conformation of d-3-hydroxybutyrate dehydrogenase complexed with NAD+ and l-3-hydroxybutyrate (see paper)
39% identity, 98% coverage: 3:257/260 of query aligns to 2:257/260 of 2ztlA
- active site: G15 (= G16), N114 (≠ H113), S142 (= S142), Y155 (= Y155), K159 (= K159), L200 (≠ Q200)
- binding (3s)-3-hydroxybutanoic acid: Q94 (= Q93), S142 (= S142), H144 (= H144), K152 (= K152), Y155 (= Y155), Q196 (= Q196)
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), G15 (= G16), I16 (= I17), F36 (vs. gap), L64 (≠ V63), N90 (= N89), A91 (= A90), G92 (= G91), L113 (≠ I112), Y155 (= Y155), K159 (= K159), P185 (= P185), W187 (≠ F187), V188 (= V188), T190 (= T190), V193 (= V193)
1wmbA Crystal structure of NAD dependent d-3-hydroxybutylate dehydrogenase (see paper)
39% identity, 98% coverage: 3:257/260 of query aligns to 2:257/260 of 1wmbA
5b4tA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and a substrate d-3- hydroxybutyrate (see paper)
36% identity, 98% coverage: 3:257/260 of query aligns to 2:257/260 of 5b4tA
- active site: G15 (= G16), N114 (≠ H113), S142 (= S142), Y155 (= Y155), K159 (= K159), I200 (≠ Q200)
- binding (3R)-3-hydroxybutanoic acid: Q94 (= Q93), S142 (= S142), H144 (= H144), K152 (= K152), Y155 (= Y155), W187 (≠ F187), Q196 (= Q196)
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), T13 (≠ A14), G15 (= G16), I16 (= I17), F36 (≠ Q43), D63 (= D62), L64 (≠ V63), N90 (= N89), G92 (= G91), L113 (≠ I112), I140 (≠ M140), Y155 (= Y155), K159 (= K159), P185 (= P185), G186 (= G186), W187 (≠ F187), V188 (= V188), T190 (= T190), L192 (= L192), V193 (= V193)
3w8dA Crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with NAD+ and an inhibitor methylmalonate
36% identity, 98% coverage: 3:257/260 of query aligns to 2:257/260 of 3w8dA
- active site: G15 (= G16), N114 (≠ H113), S142 (= S142), Y155 (= Y155), K159 (= K159), I200 (≠ Q200)
- binding methylmalonic acid: Q94 (= Q93), S142 (= S142), H144 (= H144), K152 (= K152), Y155 (= Y155), W187 (≠ F187), Q196 (= Q196), W257 (= W257)
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), T13 (≠ A14), S14 (= S15), G15 (= G16), I16 (= I17), F36 (≠ Q43), A62 (≠ M61), D63 (= D62), L64 (≠ V63), N90 (= N89), A91 (= A90), G92 (= G91), L113 (≠ I112), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), G186 (= G186), W187 (≠ F187), V188 (= V188), T190 (= T190), L192 (= L192), V193 (= V193)
3vdrA Crystal structure of d-3-hydroxybutyrate dehydrogenase, prepared in the presence of the substrate d-3-hydroxybutyrate and NAD(+) (see paper)
36% identity, 98% coverage: 3:257/260 of query aligns to 2:257/260 of 3vdrA
- active site: G15 (= G16), N114 (≠ H113), S142 (= S142), Y155 (= Y155), K159 (= K159), I200 (≠ Q200)
- binding (3R)-3-hydroxybutanoic acid: Q94 (= Q93), H144 (= H144), K152 (= K152), Y155 (= Y155), W187 (≠ F187), Q196 (= Q196), W257 (= W257)
- binding acetoacetic acid: Q94 (= Q93), H144 (= H144), K152 (= K152), Y155 (= Y155), W187 (≠ F187), Q196 (= Q196), W257 (= W257)
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), T13 (≠ A14), I16 (= I17), F36 (≠ Q43), D63 (= D62), L64 (≠ V63), N90 (= N89), A91 (= A90), G92 (= G91), L113 (≠ I112), K159 (= K159), G186 (= G186), V188 (= V188), T190 (= T190), L192 (= L192), V193 (= V193)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G12), T13 (≠ A14), I16 (= I17), F36 (≠ Q43), D63 (= D62), L64 (≠ V63), N90 (= N89), A91 (= A90), G92 (= G91), L113 (≠ I112), S142 (= S142), Y155 (= Y155), K159 (= K159), G186 (= G186), V188 (= V188), T190 (= T190), L192 (= L192), V193 (= V193)
3vdqA Crystal structure of alcaligenes faecalis d-3-hydroxybutyrate dehydrogenase in complex with NAD(+) and acetate (see paper)
36% identity, 98% coverage: 3:257/260 of query aligns to 2:257/260 of 3vdqA
- active site: G15 (= G16), N114 (≠ H113), S142 (= S142), Y155 (= Y155), K159 (= K159), I200 (≠ Q200)
- binding acetate ion: Q94 (= Q93), H144 (= H144), K152 (= K152), W187 (≠ F187), L192 (= L192), Q196 (= Q196)
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), S14 (= S15), I16 (= I17), F36 (≠ Q43), D63 (= D62), L64 (≠ V63), N90 (= N89), A91 (= A90), G92 (= G91), L113 (≠ I112), I140 (≠ M140), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), G186 (= G186), W187 (≠ F187), V188 (= V188), T190 (= T190), L192 (= L192), V193 (= V193)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
36% identity, 98% coverage: 3:257/260 of query aligns to 3:245/248 of 6ixmC
- active site: G16 (= G16), S142 (= S142), Y155 (= Y155), K159 (= K159)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), S15 (= S15), G16 (= G16), I17 (= I17), D36 (= D36), I37 (≠ L37), A61 (≠ M61), D62 (= D62), T63 (≠ V63), N89 (= N89), A90 (= A90), M140 (= M140), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), A186 (≠ G186), Y187 (≠ F187), I188 (≠ V188), L192 (= L192)
2q2qD Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida (see paper)
36% identity, 99% coverage: 3:260/260 of query aligns to 2:255/255 of 2q2qD
- active site: G15 (= G16), S138 (= S142), Y151 (= Y155), K155 (= K159), R196 (≠ Q200)
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), T13 (≠ A14), S14 (= S15), G15 (= G16), I16 (= I17), F36 (≠ L37), D59 (= D62), L60 (≠ V63), N86 (= N89), G88 (= G91), L109 (≠ I112), I136 (≠ M140), S138 (= S142), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (= G186), W183 (≠ F187), V184 (= V188), T186 (= T190), L188 (= L192), V189 (= V193)
1x1tA Crystal structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas fragi complexed with NAD+ (see paper)
37% identity, 98% coverage: 3:257/260 of query aligns to 2:233/236 of 1x1tA
- active site: G15 (= G16), N114 (≠ H113), S142 (= S142), Y155 (= Y155), K159 (= K159)
- binding cacodylate ion: S142 (= S142), H144 (= H144), Y155 (= Y155), W187 (≠ F187), W233 (= W257)
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), T13 (≠ A14), S14 (= S15), G15 (= G16), I16 (= I17), G35 (vs. gap), F36 (vs. gap), D63 (= D62), L64 (≠ V63), N90 (= N89), G92 (= G91), L113 (≠ I112), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), W187 (≠ F187), V188 (= V188), T190 (= T190)
5yssB Crystal structure of aminocaproic acid cyclase in complex with NAD (+) (see paper)
36% identity, 99% coverage: 3:260/260 of query aligns to 2:255/255 of 5yssB
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), T13 (≠ A14), S14 (= S15), G15 (= G16), I16 (= I17), G35 (≠ D36), F36 (≠ L37), L60 (≠ V63), N86 (= N89), G88 (= G91), I89 (= I92), A137 (≠ G141), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (= G186), V184 (= V188), T186 (= T190)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
32% identity, 98% coverage: 1:256/260 of query aligns to 1:242/248 of Q9KJF1
- M1 (= M1) modified: Initiator methionine, Removed
- S15 (= S15) binding
- D36 (= D36) binding
- D62 (= D62) binding
- I63 (≠ V63) binding
- N89 (= N89) binding
- Y153 (= Y155) binding
- K157 (= K159) binding
Q48436 Diacetyl reductase [(S)-acetoin forming]; Acetoin(diacetyl) reductase; AR; Meso-2,3-butanediol dehydrogenase; EC 1.1.1.304 from Klebsiella pneumoniae (see paper)
34% identity, 97% coverage: 6:256/260 of query aligns to 3:252/256 of Q48436
- 6:33 (vs. 9:36, 57% identical) binding
- D59 (= D62) binding
- K156 (= K159) binding
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
33% identity, 98% coverage: 3:256/260 of query aligns to 5:254/258 of 3ak4A
- active site: G18 (= G16), S141 (= S142), L151 (≠ K152), Y154 (= Y155), K158 (= K159), E199 (≠ Q200)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ S15), G18 (= G16), I19 (= I17), D38 (= D36), L39 (= L37), V60 (≠ M61), D61 (= D62), V62 (= V63), N88 (= N89), A89 (= A90), G90 (= G91), T139 (≠ M140), S141 (= S142), Y154 (= Y155), K158 (= K159), G185 (= G186), V187 (= V188), T189 (= T190), M191 (≠ L192)
1gegE Cryatal structure analysis of meso-2,3-butanediol dehydrogenase (see paper)
34% identity, 97% coverage: 6:256/260 of query aligns to 3:252/256 of 1gegE
- active site: G13 (= G16), S139 (= S142), Y152 (= Y155), K156 (= K159), V197 (≠ I197)
- binding alpha-D-glucopyranose: R63 (≠ E66), D64 (≠ E67), F67 (≠ N70), E123 (≠ R126)
- binding nicotinamide-adenine-dinucleotide: G9 (= G12), Q12 (≠ S15), I14 (= I17), D33 (= D36), Y34 (≠ L37), V58 (≠ M61), D59 (= D62), V60 (= V63), N86 (= N89), A87 (= A90), I109 (= I112), S139 (= S142), Y152 (= Y155), K156 (= K159), P182 (= P185), V185 (= V188), T187 (= T190), M189 (≠ L192)
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
35% identity, 99% coverage: 3:260/260 of query aligns to 3:254/256 of 7do7A
- active site: G16 (= G16), S146 (= S142), Y159 (= Y155)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), R15 (≠ S15), G16 (= G16), I17 (= I17), S37 (vs. gap), D66 (= D62), A67 (≠ V63), N93 (= N89), A94 (= A90), G95 (= G91), I96 (= I92), V144 (≠ M140), S145 (≠ G141), S146 (= S142), Y159 (= Y155), K163 (= K159), P189 (= P185), G190 (= G186), I192 (≠ V188), T194 (= T190), I196 (≠ L192)
- binding beta-L-rhamnopyranose: F99 (≠ V95), S146 (= S142), S148 (≠ H144), Q156 (≠ K152), Y159 (= Y155), N197 (≠ V193), D235 (≠ F241), M236 (≠ E242), R238 (≠ S244)
Query Sequence
>BPHYT_RS11930 FitnessBrowser__BFirm:BPHYT_RS11930
MALNDKVALVTGAASGIGEQCARKLAADGATVVIADLNLVNAQKVAEDIVKTGAKAIAIG
MDVTSEESVNAGVAETVRRLGSLDVLVSNAGIQIVNRIEEYPFADWKKMLAIHLDGAFLT
TKAAIRHMYASKKGGAVIYMGSVHSHEASQLKSAYVTAKHGLLGLARVVAKEGGPHGVRA
NVVCPGFVRTPLVDKQIPEQAKALGISEQQVVSDVMLKDTVDGEFTSVDDVANTVAFLAG
FESSALTGQSIVVSHGWFMQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory