SitesBLAST
Comparing BPHYT_RS13055 FitnessBrowser__BFirm:BPHYT_RS13055 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4esoB Crystal structure of a putative oxidoreductase protein from sinorhizobium meliloti 1021 in complex with NADP
40% identity, 98% coverage: 4:248/249 of query aligns to 3:246/251 of 4esoB
- active site: G16 (= G17), S136 (= S137), M146 (≠ S147), Y149 (= Y150), K153 (= K154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), T14 (≠ S15), H15 (≠ S16), M17 (≠ I18), R37 (= R38), N38 (≠ D39), N41 (≠ A42), S58 (≠ N59), D59 (= D60), I60 (≠ V64), N86 (= N87), A87 (= A88), G88 (= G89), T134 (≠ N135), S136 (= S137), Y149 (= Y150), P179 (= P180), G180 (= G181), I182 (≠ V183), T184 (= T185), T186 (≠ L187), K187 (≠ Y188), G188 (= G189)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
36% identity, 100% coverage: 1:249/249 of query aligns to 1:249/249 of 4bmsF
- active site: S137 (= S137), H147 (≠ S147), Y150 (= Y150), K154 (= K154), Q195 (≠ A195)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), N15 (≠ S15), S16 (= S16), I18 (= I18), R38 (= R38), R39 (≠ D39), A59 (≠ N59), D60 (= D60), V61 (≠ A61), N87 (= N87), S88 (≠ A88), G89 (= G89), V110 (≠ T110), S137 (= S137), Y150 (= Y150), K154 (= K154), G181 (= G181), I183 (≠ V183), T185 (= T185), I187 (≠ L187)
6ihhA Crystal structure of rasadh f12 from ralstonia.Sp in complex with NADPH and a6o
38% identity, 100% coverage: 1:249/249 of query aligns to 1:249/249 of 6ihhA
- binding (2R,3S)-2-ethyl-2-[(2E)-2-(6-methoxy-3,4-dihydro-2H-naphthalen-1-ylidene)ethyl]-3-oxidanyl-cyclopentan-1-one: S137 (= S137), H147 (≠ S147), Y150 (= Y150), L188 (= L187), L246 (≠ M246)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), N15 (≠ S15), S16 (= S16), G17 (= G17), I18 (= I18), R38 (= R38), R39 (≠ D39), D60 (= D60), V61 (≠ A61), N87 (= N87), S88 (≠ A88), G89 (= G89), V110 (≠ T110), T135 (≠ N135), S137 (= S137), Y150 (= Y150), K154 (= K154), P180 (= P180), G181 (= G181), A182 (≠ P182), I183 (≠ V183), T185 (= T185), S187 (vs. gap)
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
41% identity, 98% coverage: 3:245/249 of query aligns to 3:237/241 of 5t2uA
- active site: G17 (= G17), T135 (≠ S137), T145 (≠ S147), Y148 (= Y150), K152 (= K154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), G17 (= G17), R38 (= R38), D39 (= D39), R42 (≠ A42), D60 (= D60), L61 (≠ A61), N83 (= N87), A84 (= A88), Y87 (≠ A91), I133 (vs. gap), T135 (≠ S137), Y148 (= Y150), K152 (= K154), P178 (= P180), P180 (= P182), T181 (≠ V183), T183 (= T185), T185 (≠ L187), T186 (vs. gap)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
38% identity, 99% coverage: 1:247/249 of query aligns to 6:253/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G13), S20 (= S15), K21 (≠ S16), G22 (= G17), I23 (= I18), A43 (vs. gap), S44 (vs. gap), S45 (≠ T36), G68 (≠ N59), D69 (= D60), V70 (≠ A61), N96 (= N87), S97 (≠ A88), G98 (= G89), Y100 (≠ A91), I144 (≠ N135), S146 (= S137), Y159 (= Y150), K163 (= K154), P189 (= P180), G190 (= G181), M191 (≠ P182), I192 (≠ V183), T194 (= T185), G196 (≠ L187), T197 (≠ Y188)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S137), Y159 (= Y150), M191 (≠ P182), I202 (≠ L193)
D4A1J4 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Rattus norvegicus (Rat) (see paper)
34% identity, 99% coverage: 1:247/249 of query aligns to 1:244/245 of D4A1J4
- Y147 (= Y150) mutation to F: Loss of function.
Q8JZV9 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Mus musculus (Mouse) (see paper)
33% identity, 99% coverage: 1:247/249 of query aligns to 1:244/245 of Q8JZV9
- Y147 (= Y150) active site, Proton acceptor; mutation to F: Loss of function.
2b4qA Pseudomonas aeruginosa rhlg/NADP active-site complex (see paper)
38% identity, 96% coverage: 6:245/249 of query aligns to 9:253/256 of 2b4qA
- active site: G20 (= G17), S148 (= S137), V149 (≠ I138), Y162 (= Y150), K166 (= K154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G13), S18 (= S15), R19 (≠ S16), I21 (= I18), A40 (≠ G37), R41 (= R38), D42 (= D39), D65 (= D60), L66 (≠ A61), S67 (≠ G62), N92 (= N87), A93 (= A88), G94 (= G89), I146 (vs. gap), G147 (= G136), S148 (= S137), Y162 (= Y150), K166 (= K154), P192 (= P180), G193 (= G181), R194 (≠ P182), F195 (≠ V183), S197 (≠ T185), M199 (≠ L187)
7ejhA Crystal structure of kred mutant-f147l/l153q/y190p/l199a/m205f/m206f and 2-hydroxyisoindoline-1,3-dione complex
36% identity, 98% coverage: 3:247/249 of query aligns to 5:251/253 of 7ejhA
- binding 2-oxidanylisoindole-1,3-dione: S144 (= S137), I145 (= I138), E146 (≠ N139), Y157 (= Y150), V197 (≠ Y188), F207 (≠ A202)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), T17 (≠ S15), I20 (= I18), R40 (= R38), H41 (≠ D39), D64 (= D60), A65 (= A61), N91 (= N87), A92 (= A88), V114 (≠ T110), M142 (≠ N135), S144 (= S137), Y157 (= Y150), K161 (= K154), P189 (= P180), G190 (= G181), P191 (= P182), I192 (≠ V183), T194 (= T185), P195 (= P186), L196 (= L187)
7ejiB Crystal structure of kred f147l/l153q/y190p/l199a/m205f/m206f variant and methyl methacrylate complex
36% identity, 98% coverage: 3:247/249 of query aligns to 3:249/251 of 7ejiB
- binding methyl 2-methylprop-2-enoate: S142 (= S137), I143 (= I138), Y155 (= Y150), F205 (≠ A202)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), T15 (≠ S15), L16 (≠ S16), G17 (= G17), I18 (= I18), R38 (= R38), H39 (≠ D39), D62 (= D60), A63 (= A61), N89 (= N87), A90 (= A88), V112 (≠ T110), M140 (≠ N135), S142 (= S137), Y155 (= Y150), K159 (= K154), P187 (= P180), P189 (= P182), I190 (≠ V183), T192 (= T185), P193 (= P186), L194 (= L187)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
37% identity, 98% coverage: 4:246/249 of query aligns to 3:245/247 of 4jroC
- active site: G16 (= G17), S142 (= S137), Q152 (≠ S147), Y155 (= Y150), K159 (= K154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (= S15), R15 (≠ S16), G16 (= G17), I17 (= I18), N35 (≠ T36), Y36 (vs. gap), N37 (vs. gap), G38 (= G37), S39 (≠ R38), N63 (≠ S63), V64 (= V64), N90 (= N87), A91 (= A88), I93 (≠ T90), I113 (≠ T110), S142 (= S137), Y155 (= Y150), K159 (= K154), P185 (= P180), I188 (≠ V183), T190 (= T185)
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
36% identity, 96% coverage: 7:246/249 of query aligns to 6:251/256 of 7do7A
- active site: G16 (= G17), S146 (= S137), Y159 (= Y150)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), R15 (≠ S16), G16 (= G17), I17 (= I18), S37 (≠ T36), D66 (= D60), A67 (= A61), N93 (= N87), A94 (= A88), G95 (= G89), I96 (≠ T90), V144 (≠ N135), S145 (≠ G136), S146 (= S137), Y159 (= Y150), K163 (= K154), P189 (= P180), G190 (= G181), I192 (≠ V183), T194 (= T185), I196 (≠ L187)
- binding beta-L-rhamnopyranose: F99 (= F93), S146 (= S137), S148 (≠ N139), Q156 (≠ S147), Y159 (= Y150), N197 (≠ Y188), D235 (≠ P230), M236 (≠ E231), R238 (≠ A233)
7b81A Crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase (NAD bound-form) (see paper)
36% identity, 96% coverage: 7:246/249 of query aligns to 6:251/256 of 7b81A
- active site: G16 (= G17), S146 (= S137), Y159 (= Y150)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), S14 (= S15), R15 (≠ S16), I17 (= I18), D66 (= D60), A67 (= A61), N93 (= N87), A94 (= A88), G95 (= G89), I96 (≠ T90), T116 (= T110), V144 (≠ N135), S146 (= S137), Y159 (= Y150), K163 (= K154), P189 (= P180), G190 (= G181), I192 (≠ V183), T194 (= T185), I196 (≠ L187)
5t5qC Crystal structure of short-chain dehydrogenase/reductase sdr:glucose/ribitol dehydrogenase from brucella melitensis
32% identity, 98% coverage: 3:246/249 of query aligns to 4:242/245 of 5t5qC
- active site: G18 (= G17), S140 (= S137), N150 (≠ S147), Y153 (= Y150), K157 (= K154)
- binding nicotinamide-adenine-dinucleotide: N16 (≠ S15), G17 (≠ S16), G18 (= G17), I19 (= I18), D38 (≠ G37), L39 (≠ R38), D63 (= D60), A64 (= A61), S90 (≠ N87), I113 (≠ T110), Y153 (= Y150), K157 (= K154), P182 (= P180), I185 (≠ V183), T187 (= T185), M189 (≠ L187)
Q6WVP7 NADP-dependent (R)-specific alcohol dehydrogenase; (R)-specific ADH; Ketoreductase; KRED; EC 1.1.1.- from Lentilactobacillus kefiri (Lactobacillus kefiri) (see paper)
35% identity, 98% coverage: 3:247/249 of query aligns to 4:250/252 of Q6WVP7
Sites not aligning to the query:
2ag5A Crystal structure of human dhrs6 (see paper)
34% identity, 99% coverage: 1:247/249 of query aligns to 1:244/246 of 2ag5A
- active site: S133 (= S137), Y147 (= Y150), K151 (= K154), R192 (≠ A195)
- binding nicotinamide-adenine-dinucleotide: Q16 (≠ S16), G17 (= G17), I18 (= I18), D37 (≠ G37), I38 (≠ R38), D58 (≠ S63), V59 (= V64), V81 (≠ N87), G83 (= G89), L104 (≠ T110), Y147 (= Y150), K151 (= K154), P177 (= P180), V180 (= V183), T182 (= T185), S184 (≠ L187)
- binding sulfate ion: R144 (≠ S147), R188 (≠ L191), F202 (≠ I205), R205 (≠ Q208)
Q9BUT1 Dehydrogenase/reductase SDR family member 6; (R)-beta-hydroxybutyrate dehydrogenase; 3-hydroxybutyrate dehydrogenase type 2; 4-oxo-L-proline reductase; Oxidoreductase UCPA; Short chain dehydrogenase/reductase family 15C member 1; EC 1.1.1.-; EC 1.1.1.30; EC 1.1.1.104 from Homo sapiens (Human) (see 4 papers)
34% identity, 99% coverage: 1:247/249 of query aligns to 1:244/245 of Q9BUT1
4nbuB Crystal structure of fabg from bacillus sp (see paper)
33% identity, 99% coverage: 1:246/249 of query aligns to 2:242/244 of 4nbuB
- active site: G18 (= G17), N111 (= N111), S139 (= S137), Q149 (≠ S147), Y152 (= Y150), K156 (= K154)
- binding acetoacetyl-coenzyme a: D93 (≠ F93), K98 (≠ D98), S139 (= S137), N146 (≠ M144), V147 (≠ P145), Q149 (≠ S147), Y152 (= Y150), F184 (≠ P182), M189 (≠ L187), K200 (≠ Q204)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), N17 (≠ S16), G18 (= G17), I19 (= I18), D38 (≠ G37), F39 (≠ R38), V59 (≠ N59), D60 (= D60), V61 (≠ A61), N87 (= N87), A88 (= A88), G89 (= G89), I90 (≠ T90), T137 (vs. gap), S139 (= S137), Y152 (= Y150), K156 (= K154), P182 (= P180), F184 (≠ P182), T185 (≠ V183), T187 (= T185), M189 (≠ L187)
7do6A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NADP bound-form) (see paper)
35% identity, 96% coverage: 7:246/249 of query aligns to 6:242/247 of 7do6A
- active site: G16 (= G17), S146 (= S137), Y159 (= Y150)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (= S15), R15 (≠ S16), G16 (= G17), I17 (= I18), H36 (vs. gap), S37 (≠ T36), G42 (vs. gap), D66 (= D60), A67 (= A61), N93 (= N87), A94 (= A88), G95 (= G89), I96 (≠ T90), T116 (= T110), S146 (= S137), Y159 (= Y150), K163 (= K154), I192 (≠ V183)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
34% identity, 96% coverage: 7:246/249 of query aligns to 2:237/239 of 3sj7A
- active site: G12 (= G17), S138 (= S137), Q148 (≠ S147), Y151 (= Y150), K155 (= K154)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), S10 (= S15), R11 (≠ S16), I13 (= I18), N31 (vs. gap), Y32 (vs. gap), A33 (vs. gap), G34 (vs. gap), S35 (≠ T36), A58 (≠ G62), N59 (≠ S63), V60 (= V64), N86 (= N87), A87 (= A88), T109 (= T110), S138 (= S137), Y151 (= Y150), K155 (= K154), P181 (= P180), G182 (= G181)
Query Sequence
>BPHYT_RS13055 FitnessBrowser__BFirm:BPHYT_RS13055
MTRFQGKSVLVTGGSSGIGFAAAKAFADEGARVVITGRDAAALETARKALGADAVAVRND
AGSVASARELAAAISAVGIRLDAVFVNAGTAKFAPFPDVDEAFWDAMFNTNVKGAYFQIQ
ALLPLLNRGASIVINGSINAHIGMPASSVYAASKAAVISLAKTLSSELLPQGVRVNVVSP
GPVQTPLYGKLGLDAAALEATAAQILGQVPVGRFGTPEEIASTVLHLSAPESAFIVGTEI
IADGGMSQL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory