SitesBLAST
Comparing BPHYT_RS13510 FitnessBrowser__BFirm:BPHYT_RS13510 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
30% identity, 98% coverage: 5:410/416 of query aligns to 11:422/425 of O59010
- S65 (≠ T57) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ S269) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ STS 269:271) binding
- M311 (≠ L304) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (= T307) binding
- V355 (= V348) binding
- D394 (≠ S382) binding
- M395 (≠ E383) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R385) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N389) binding
- D405 (≠ N393) mutation to N: Strongly decreased affinity for aspartate.
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
31% identity, 98% coverage: 6:411/416 of query aligns to 11:423/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
31% identity, 98% coverage: 6:411/416 of query aligns to 11:423/427 of 5e9sA
- binding aspartic acid: R274 (≠ S269), S275 (≠ T270), S276 (= S271), T313 (= T307), G353 (= G347), V354 (= V348), A357 (= A351), G358 (= G352), D394 (≠ S382), R397 (= R385), T398 (≠ A386)
- binding decyl-beta-d-maltopyranoside: L194 (≠ R189), G198 (≠ M193), Y202 (≠ L197)
- binding sodium ion: Y87 (≠ F82), T90 (≠ V85), S91 (= S86), S276 (= S271), G305 (= G299), A306 (≠ Y300), T307 (≠ S301), N309 (= N303), N309 (= N303), M310 (≠ L304), D311 (= D305), S348 (= S342), I349 (≠ K343), G350 (= G344), T351 (≠ S345), N401 (= N389), V402 (≠ T390), D405 (≠ N393)
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
31% identity, 98% coverage: 6:411/416 of query aligns to 8:420/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ R189), G195 (≠ M193), R282 (≠ E280)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ S269), S272 (≠ T270), S273 (= S271), M307 (≠ L304), T310 (= T307), G353 (= G350), A354 (= A351), R394 (= R385), T395 (≠ A386)
Sites not aligning to the query:
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
31% identity, 98% coverage: 6:411/416 of query aligns to 9:421/425 of 6zgbA
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
30% identity, 98% coverage: 6:411/416 of query aligns to 4:412/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ S269), S265 (= S271), M299 (≠ L304), T302 (= T307), T340 (≠ S345), G342 (= G347), V343 (= V348), G347 (= G352), D383 (≠ S382), R386 (= R385), T387 (≠ A386), N390 (= N389)
- binding decyl-beta-d-maltopyranoside: H23 (= H26), V212 (≠ L218), A216 (≠ M222)
2nwwA Crystal structure of gltph in complex with tboa (see paper)
30% identity, 96% coverage: 5:404/416 of query aligns to 2:407/407 of 2nwwA
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
30% identity, 96% coverage: 5:404/416 of query aligns to 3:408/409 of 6bavA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
30% identity, 96% coverage: 5:404/416 of query aligns to 3:408/408 of 6bauA
- binding cysteine: S270 (= S271), M303 (≠ L304), T306 (= T307), A345 (≠ T346), G346 (= G347), V347 (= V348), G351 (= G352), D386 (≠ S382), C389 (≠ R385), T390 (≠ A386), N393 (= N389)
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
29% identity, 97% coverage: 3:407/416 of query aligns to 9:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L38), F46 (≠ L38), P75 (≠ D67), L91 (≠ V84), F95 (≠ L88), L130 (= L131), I133 (≠ F134), I159 (≠ M160), Y167 (≠ V168), K196 (≠ R189), G200 (≠ M193), I207 (= I200), F210 (= F203), L250 (≠ I243), I262 (≠ V255), M269 (≠ L262), T334 (= T327), V335 (≠ I328), G336 (≠ A329), T340 (= T333), L343 (≠ A336), M399 (≠ L387)
- binding aspartic acid: S277 (≠ T270), S278 (= S271), T314 (= T307), G354 (= G347), A358 (= A351), G359 (= G352), D394 (≠ S382), R397 (= R385), T398 (≠ A386)
- binding sodium ion: Y89 (≠ F82), T92 (≠ V85), S93 (= S86), G306 (= G299), T308 (≠ S301), N310 (= N303), N310 (= N303), M311 (≠ L304), D312 (= D305), S349 (= S342), I350 (≠ K343), T352 (≠ S345), N401 (= N389), V402 (≠ T390), D405 (≠ N393)
Sites not aligning to the query:
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
29% identity, 97% coverage: 3:404/416 of query aligns to 6:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G61), V83 (≠ L79), I157 (≠ L161), Y164 (≠ V168), K193 (≠ R189), T305 (≠ S301), I306 (≠ F302), I347 (≠ K343)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ L10), M199 (≠ T195), S275 (= S271), T311 (= T307), G356 (= G352), L384 (= L375), D391 (≠ S382), R394 (= R385)
Sites not aligning to the query:
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
28% identity, 96% coverage: 5:404/416 of query aligns to 3:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
28% identity, 89% coverage: 39:409/416 of query aligns to 57:408/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ V71), G89 (= G72), G92 (= G75), A95 (= A78), V96 (≠ L79), Y99 (≠ F82), M163 (= M160), F167 (≠ T164), F293 (≠ L294), V297 (≠ T298)
- binding aspartic acid: S268 (≠ T270), S269 (= S271), T306 (= T307), G346 (= G347), I347 (≠ V348), A350 (= A351), G351 (= G352), D380 (≠ S382), R383 (= R385), T384 (≠ A386)
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
28% identity, 89% coverage: 39:409/416 of query aligns to 49:394/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I62), S80 (≠ V71), G81 (= G72), G84 (= G75), Y91 (≠ F82), M156 (= M160), F160 (≠ T164), F286 (≠ L294), V290 (≠ T298)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (= I54), I148 (= I152), S262 (= S271), S263 (≠ E272), A292 (≠ Y300), T293 (≠ S301), M296 (≠ L304), T299 (= T307), G329 (= G344), A336 (= A351), G337 (= G352), D366 (≠ S382), R369 (= R385), N373 (= N389)
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
24% identity, 98% coverage: 3:408/416 of query aligns to 17:465/503 of Q10901
- N177 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N187 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P43007 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Homo sapiens (Human) (see 4 papers)
27% identity, 91% coverage: 39:415/416 of query aligns to 79:490/532 of P43007
- N201 (≠ E129) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (≠ F134) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- E256 (≠ K185) to K: in SPATCCM; does not affect localization at the cell surface; decreased uptake of L-serine and L-alanine; Vmax is decreased by at least 50% for both substrates; 3-fold increase of affinity for L-serine; 2-fold increase of affinity for L-alanine; dbSNP:rs201278558
- R457 (≠ E383) to W: in SPATCCM; does not affect localization at the cell surface; loss of uptake of L-serine and L-alanine; dbSNP:rs761533681
O35874 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Mus musculus (Mouse) (see 2 papers)
26% identity, 90% coverage: 39:414/416 of query aligns to 79:496/532 of O35874
- N201 (≠ G128) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (≠ G133) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P43003 Excitatory amino acid transporter 1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Homo sapiens (Human) (see 3 papers)
24% identity, 96% coverage: 15:412/416 of query aligns to 55:502/542 of P43003
- S363 (= S269) mutation to R: Loss of electrogenic glutamate transport. Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with M-477.
- SSS 363:365 (≠ STS 269:271) binding
- T396 (≠ S301) binding
- T402 (= T307) binding
- IPQAG 443:447 (≠ VTGAG 348:352) binding
- D476 (≠ S382) binding
- R477 (≠ E383) mutation to M: Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with R-363.
- N483 (= N389) binding
Sites not aligning to the query:
- 523 Y→F: No effect on activity.
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
24% identity, 96% coverage: 15:413/416 of query aligns to 55:503/543 of P56564
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N216 (≠ Y121) modified: carbohydrate, N-linked (GlcNAc...) asparagine
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
25% identity, 89% coverage: 39:408/416 of query aligns to 47:419/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (≠ T270), S281 (= S271), T318 (= T307), G363 (= G352), M367 (≠ L356), V385 (≠ L375), D388 (= D378), R395 (= R385), T396 (≠ A386)
- binding dodecyl beta-D-glucopyranoside: W389 (≠ R379)
- binding cholesterol hemisuccinate: R80 (= R73), R84 (≠ K77), I95 (≠ L88), I252 (≠ F233)
Sites not aligning to the query:
Query Sequence
>BPHYT_RS13510 FitnessBrowser__BFirm:BPHYT_RS13510
MKRKPLYKVLYVQVIVAIIIGVALGHFLPADAVAMKPLGDAFIKLVRMIISPVIFCTVVT
GIASMHDMRKVGRVGGKALLYFEVVSTLALAIGLLAAHVLKPGIGFNVDPSTLDAGAIAS
YAAQAAHGEGLAGFFMHIIPDTFAGAFTQGDILPVLLIAMLFGTALAVLGEPAKPLIGLI
DLLSKTFFRIVRMITSLAPIGAFGAIAFTIGKYGIVSLLPMMKLIGTFYLTAFLFVSCGL
GLIARACGFSLWRFVVYIKDELLIVLGTSTSEAALPQLMEKLERLGCSRGIVGLVVPTGY
SFNLDGTNIYMTLAVLFLAQATNTHLTIAQEITLLAVTMLTSKGSTGVTGAGFITLAASL
SVVPTVPVTAMVLILGIDRFMSECRALTNTMGNGVASIVIAAWEKELDRGKLNAAL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory