Comparing BPHYT_RS13705 BPHYT_RS13705 chorismate synthase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
1um0A Crystal structure of chorismate synthase complexed with fmn (see paper)
47% identity, 93% coverage: 4:345/366 of query aligns to 2:348/365 of 1um0A
P56122 Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EC 4.2.3.5 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
47% identity, 93% coverage: 4:345/366 of query aligns to 2:348/365 of P56122
Q12640 Chorismate synthase aro-2; 5-enolpyruvylshikimate-3-phosphate phospholyase; EC 1.5.1.38; EC 4.2.3.5 from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) (see 3 papers)
39% identity, 95% coverage: 4:350/366 of query aligns to 2:396/432 of Q12640
2qhfA Mycobacterium tuberculosis chorismate synthase in complex with nca
38% identity, 91% coverage: 14:345/366 of query aligns to 6:367/392 of 2qhfA
P9WPY1 Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EC 4.2.3.5 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
38% identity, 91% coverage: 14:345/366 of query aligns to 6:367/401 of P9WPY1
2o12A Mycobacterium tuberculosis chorismate synthase in complex with fmn
38% identity, 91% coverage: 14:345/366 of query aligns to 6:361/386 of 2o12A
1qxoA Crystal structure of chorismate synthase complexed with oxidized fmn and epsp (see paper)
36% identity, 91% coverage: 14:345/366 of query aligns to 5:363/388 of 1qxoA
P0A2Y6 Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EC 4.2.3.5 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see paper)
36% identity, 91% coverage: 14:345/366 of query aligns to 5:363/388 of P0A2Y6
>BPHYT_RS13705 BPHYT_RS13705 chorismate synthase
MSGNTLGTLFTVTTFGESHGPAIGCVIDGCPPGMALNEADIQFELDRRKPGTSRHVTQRQ
EEDKVEILSGVFEGQTTGAPIALLIRNTDQRSKDYGNIADTFRPGHADYTYWQKYGIRDY
RGGGRSSARLTAPTVAAGAVAKKWLREKFGTEIHGYMAALGEIDVPFVDWAHVRENPFFA
PNAQIVPQLETYMDALRKDGDSIGARINVVASGVPVGLGEPLFDRLDADIAHAMMGINAV
KGVEIGAGFASIAQRGSVHGDELTPEGFVGNHAGGVLGGISTGQDVTVSIAIKPTSSIRT
PRRSIDKAGQPVVVETFGRHDPCVGIRATPIAESMLALVLIDHALRHRAQCGDVAVSTPK
IAASAP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory