SitesBLAST
Comparing BPHYT_RS13880 FitnessBrowser__BFirm:BPHYT_RS13880 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4n54A Crystal structure of scyllo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD(h) and scyllo-inositol
39% identity, 98% coverage: 8:349/349 of query aligns to 3:338/340 of 4n54A
- active site: K96 (= K101), H183 (= H186)
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: R12 (= R17), K96 (= K101), D156 (= D161), D179 (= D182), M180 (≠ C183), H183 (= H186), R238 (= R242), Y244 (≠ N248)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V8 (= V13), G9 (= G14), L10 (= L15), G11 (= G16), R12 (= R17), L13 (= L18), S35 (= S40), V36 (≠ P41), E40 (= E45), S73 (≠ T78), P74 (= P79), F77 (≠ L82), H78 (= H83), E95 (= E100), K96 (= K101), M125 (= M130), F167 (= F172), F284 (= F288)
3ceaA Crystal structure of myo-inositol 2-dehydrogenase (np_786804.1) from lactobacillus plantarum at 2.40 a resolution
33% identity, 98% coverage: 8:349/349 of query aligns to 5:340/342 of 3ceaA
- active site: K98 (= K101), H185 (= H186)
- binding nicotinamide-adenine-dinucleotide: G11 (= G14), G13 (= G16), R14 (= R17), L15 (= L18), L38 (≠ P41), Q42 (≠ E45), V74 (= V77), A75 (≠ T78), P76 (= P79), T77 (≠ S80), F79 (≠ L82), H80 (= H83), M83 (≠ Q86), E97 (= E100), K98 (= K101), M127 (= M130), F169 (= F172), H185 (= H186), F286 (= F288)
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
28% identity, 92% coverage: 8:327/349 of query aligns to 3:313/336 of 3ec7A
- active site: K97 (= K101), H176 (= H186)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), M12 (≠ R17), I13 (≠ L18), D35 (≠ S40), I36 (≠ P41), R40 (≠ E43), T73 (≠ V77), A74 (≠ T78), S75 (≠ P79), N76 (≠ S80), H79 (= H83), E96 (= E100), K97 (= K101), M126 (= M130), W271 (≠ F288), Y279 (≠ F296)
4l8vA Crystal structure of a12k/d35s mutant myo-inositol dehydrogenase from bacillus subtilis with bound cofactor NADP (see paper)
25% identity, 91% coverage: 8:325/349 of query aligns to 3:311/337 of 4l8vA
- active site: K97 (= K101), H176 (= H186)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ R17), I13 (≠ L18), S74 (≠ T78), W75 (≠ P79), H79 (= H83), E96 (= E100), K97 (= K101), M126 (= M130), W272 (≠ F288), Y280 (≠ F296)
4mjlD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD and d-chiro-inositol
28% identity, 86% coverage: 8:307/349 of query aligns to 3:293/339 of 4mjlD
- active site: K97 (= K101)
- binding (1r,2r,3s,4s,5s,6s)-cyclohexane-1,2,3,4,5,6-hexol: K97 (= K101), H155 (≠ T159), N157 (≠ D161), D172 (= D182), T173 (≠ C183), H176 (= H186), Y236 (≠ N248)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), A12 (≠ R17), M13 (≠ L18), D35 (≠ P41), I36 (≠ V42), V73 (= V77), S74 (≠ T78), H79 (= H83), E96 (= E100), K97 (= K101), M126 (= M130), D172 (= D182), W274 (≠ F288), Y282 (≠ F296)
4mioD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
28% identity, 86% coverage: 8:307/349 of query aligns to 3:293/339 of 4mioD
- active site: K97 (= K101)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K97 (= K101), H155 (≠ T159), N157 (≠ D161), D172 (= D182), T173 (≠ C183), H176 (= H186), Y236 (≠ N248)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A12 (≠ R17), M13 (≠ L18), D35 (≠ P41), I36 (≠ V42), S74 (≠ T78), A78 (≠ L82), H79 (= H83), E96 (= E100), K97 (= K101), M126 (= M130), D172 (= D182), W274 (≠ F288), Y282 (≠ F296)
4mioA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
28% identity, 86% coverage: 8:307/349 of query aligns to 3:293/339 of 4mioA
- active site: K97 (= K101)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G16), A12 (≠ R17), M13 (≠ L18), D35 (≠ P41), I36 (≠ V42), S74 (≠ T78), F75 (≠ P79), H79 (= H83), E96 (= E100), K97 (= K101), W274 (≠ F288), Y282 (≠ F296)
4minA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD
28% identity, 86% coverage: 8:307/349 of query aligns to 3:293/339 of 4minA
- active site: K97 (= K101)
- binding nicotinamide-adenine-dinucleotide: G11 (= G16), A12 (≠ R17), M13 (≠ L18), D35 (≠ P41), I36 (≠ V42), V73 (= V77), S74 (≠ T78), F75 (≠ P79), H79 (= H83), E96 (= E100), K97 (= K101), Y282 (≠ F296)
3nt5A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor and product inosose (see paper)
24% identity, 91% coverage: 8:325/349 of query aligns to 3:311/337 of 3nt5A
- active site: K97 (= K101), H176 (= H186)
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: K97 (= K101), H155 (≠ T159), H176 (= H186), Y235 (≠ N248)
- binding nicotinamide-adenine-dinucleotide: G9 (= G14), G11 (= G16), A12 (≠ R17), I13 (≠ L18), D35 (≠ S40), V36 (≠ P41), S74 (≠ T78), W75 (≠ P79), G76 (≠ S80), E96 (= E100), K97 (= K101), Y280 (≠ F296)
3nt4A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor nadh and inositol (see paper)
24% identity, 91% coverage: 8:325/349 of query aligns to 3:311/337 of 3nt4A
- active site: K97 (= K101), H176 (= H186)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: H155 (≠ T159), H176 (= H186), Y235 (≠ N248), W272 (≠ F288)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G16), A12 (≠ R17), I13 (≠ L18), D35 (≠ S40), V36 (≠ P41), S74 (≠ T78), W75 (≠ P79), G76 (≠ S80), E96 (= E100), K97 (= K101), H176 (= H186)
3nt2B Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
24% identity, 91% coverage: 8:325/349 of query aligns to 3:311/337 of 3nt2B
- active site: K97 (= K101), H176 (= H186)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G14), G11 (= G16), A12 (≠ R17), D35 (≠ S40), V36 (≠ P41), S74 (≠ T78), W75 (≠ P79), A78 (≠ L82), K97 (= K101), W272 (≠ F288), Y280 (≠ F296)
3nt2A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
24% identity, 91% coverage: 8:325/349 of query aligns to 3:311/337 of 3nt2A
- active site: K97 (= K101), H176 (= H186)
- binding nicotinamide-adenine-dinucleotide: G9 (= G14), G11 (= G16), A12 (≠ R17), I13 (≠ L18), D35 (≠ S40), V36 (≠ P41), S74 (≠ T78), W75 (≠ P79), G76 (≠ S80), A78 (≠ L82), H79 (= H83), E96 (= E100), K97 (= K101), H176 (= H186), Y280 (≠ F296)
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
33% identity, 76% coverage: 8:271/349 of query aligns to 2:259/333 of 4koaA
- active site: K94 (= K101), H180 (= H186)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G14), A9 (≠ L15), S10 (≠ G16), T11 (≠ R17), I12 (≠ L18), S33 (≠ C39), S34 (= S40), R38 (≠ E44), T71 (= T78), N73 (≠ S80), H76 (= H83), K94 (= K101), Q160 (≠ D166)
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
36% identity, 58% coverage: 64:266/349 of query aligns to 56:253/332 of 2glxA
- active site: K93 (= K101), H179 (= H186)
- binding acetate ion: K93 (= K101), H179 (= H186)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S69 (≠ V77), T70 (= T78), N72 (≠ S80), H75 (= H83), E92 (= E100), K93 (= K101), H121 (≠ M130), W161 (≠ F168), R162 (≠ F169)
Sites not aligning to the query:
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
36% identity, 58% coverage: 64:266/349 of query aligns to 57:254/333 of Q2I8V6
- TTNELH 71:76 (≠ TPSSLH 78:83) binding
- EK 93:94 (= EK 100:101) binding
- K94 (= K101) mutation to G: Less than 1% remaining activity.
- N120 (≠ G128) binding
- WR 162:163 (≠ FF 168:169) binding
- D176 (= D182) mutation to A: Less than 1% remaining activity.
- H180 (= H186) mutation to A: Less than 2% remaining activity.
- G206 (≠ R216) mutation to I: No effect.
Sites not aligning to the query:
- 9:12 binding
- 10 S→G: Almost no effect.
- 13 A→G: Can use NAD as cosubstrate as well as NADP.
- 33 S→D: No activity.
- 33:34 binding
- 38 binding
- 283 binding
6jw6A The crystal structure of kand2 in complex with NAD (see paper)
31% identity, 82% coverage: 8:293/349 of query aligns to 2:272/341 of 6jw6A
- binding nicotinamide-adenine-dinucleotide: G10 (= G16), F11 (≠ R17), M12 (≠ L18), D33 (≠ E43), L34 (≠ E44), T70 (≠ V77), T71 (= T78), P72 (= P79), N73 (≠ S80), L75 (= L82), H76 (= H83), Q79 (= Q86), E93 (= E100), K94 (= K101), N122 (≠ R119), W161 (≠ F168), H179 (= H186)
Sites not aligning to the query:
6jw8A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin b (see paper)
31% identity, 82% coverage: 8:293/349 of query aligns to 2:272/342 of 6jw8A
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: F11 (≠ R17), F152 (≠ T159), N154 (≠ D161), D175 (= D182), L176 (≠ C183), H179 (= H186), E236 (≠ N248), W271 (≠ F292)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G16), F11 (≠ R17), M12 (≠ L18), D33 (≠ E43), L34 (≠ E44), T70 (≠ V77), T71 (= T78), P72 (= P79), N73 (≠ S80), L75 (= L82), H76 (= H83), Q79 (= Q86), E93 (= E100), K94 (= K101), N122 (≠ R119), W161 (≠ F168), H179 (= H186)
Sites not aligning to the query:
6jw7A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin a (see paper)
31% identity, 82% coverage: 8:293/349 of query aligns to 2:272/342 of 6jw7A
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: F11 (≠ R17), N154 (≠ D161), D175 (= D182), H179 (= H186), E236 (≠ N248), W271 (≠ F292)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G8 (= G14), G10 (= G16), F11 (≠ R17), M12 (≠ L18), D33 (≠ E43), L34 (≠ E44), T70 (≠ V77), T71 (= T78), P72 (= P79), N73 (≠ S80), L75 (= L82), H76 (= H83), Q79 (= Q86), E93 (= E100), K94 (= K101), N122 (≠ R119), W161 (≠ F168)
Sites not aligning to the query:
1rydA Crystal structure of glucose-fructose oxidoreductase from zymomonas mobilis
32% identity, 40% coverage: 59:197/349 of query aligns to 87:228/381 of 1rydA
- active site: K129 (= K101), Y217 (≠ H186)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y87 (= Y59), L106 (≠ T78), P107 (= P79), N108 (≠ S80), L110 (= L82), H111 (= H83), E128 (= E100), K129 (= K101), R157 (≠ M130), A196 (≠ S165), W199 (≠ F168), R200 (≠ F169), Y217 (≠ H186)
Sites not aligning to the query:
1h6dA Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol (see paper)
32% identity, 40% coverage: 59:197/349 of query aligns to 89:230/383 of 1h6dA
- active site: K131 (= K101), Y219 (≠ H186)
- binding glycerol: K131 (= K101), R202 (≠ F169), D215 (= D182), Y219 (≠ H186)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y89 (= Y59), I107 (≠ V77), L108 (≠ T78), P109 (= P79), N110 (≠ S80), H113 (= H83), E130 (= E100), K131 (= K101), R159 (≠ M130), A198 (≠ S165), W201 (≠ F168), R202 (≠ F169), Y219 (≠ H186)
Sites not aligning to the query:
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 17, 18, 19, 40, 41, 42, 43, 44, 66, 67, 71, 298
Query Sequence
>BPHYT_RS13880 FitnessBrowser__BFirm:BPHYT_RS13880
MTAAAPRVRVGVVGLGRLGKRHAENLAYRVPGASLVAACSPVEEERAWAREALPAPRLYE
DYAELLGDREVDAVWLVTPSSLHAQQIVDALRAGKHVFCEKPLSLDLAECERVLAESARY
PHLQATIGFMRRFDPSYRDAFEKIEAGKIGRPFLVRSQTADQNDSDGFFVRFAATSGGIF
LDCTVHDIDVARWLLGKPRAKRVFAAGAAVMHEGLREFGDVDNGVAICEFEGGKLAMFYA
SRTQAHGNDTHSEVIGTAGALAIGRNPRANRVEIYDATGIRNECTPNFFDRFEDAFLFEA
RAFVAAVRGGVGASAAQAGAGASLADAVEATRIGVALRESLLRGEAVTL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory