SitesBLAST
Comparing BPHYT_RS13915 FitnessBrowser__BFirm:BPHYT_RS13915 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6demA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide bensulfuron methyl (see paper)
25% identity, 72% coverage: 59:534/657 of query aligns to 27:497/597 of 6demA
- active site: Y33 (≠ H65), G35 (vs. gap), G36 (= G66), A37 (≠ N67), I38 (≠ V68), E59 (= E90), T82 (= T113), F121 (≠ L154), Q122 (= Q155), E123 (≠ Q156), K171 (≠ Q213), K228 (≠ D272), M264 (≠ V308), V291 (≠ T335), V407 (≠ A444), L432 (≠ Y469), G433 (≠ S470), M435 (= M472), D460 (= D497), N487 (= N524), E489 (≠ G526), Q490 (≠ Y527), M492 (≠ C529), V493 (≠ I530), W496 (≠ L533)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: M264 (≠ V308), D289 (= D333), R290 (≠ F334), M492 (≠ C529), W496 (≠ L533)
- binding flavin-adenine dinucleotide: R161 (≠ L203), G217 (= G262), A218 (≠ G263), G219 (= G264), N222 (≠ Y267), T244 (= T288), L245 (≠ Q289), Q246 (≠ A290), L262 (= L306), G284 (= G328), A285 (≠ T329), R286 (= R330), D288 (≠ Q332), R290 (≠ F334), V291 (≠ T335), E317 (vs. gap), I318 (≠ V350), N322 (≠ A354), D336 (= D368), V337 (≠ A369), M412 (≠ L454), G430 (≠ Y467)
- binding magnesium ion: D460 (= D497), N487 (= N524), E489 (≠ G526)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (≠ A444), G408 (= G445), Q409 (≠ T446), H410 (= H452), M435 (= M472), G459 (= G496), D460 (= D497), A461 (≠ G498), S462 (= S499), M465 (= M502), N487 (= N524), E489 (≠ G526), Q490 (≠ Y527), G491 (= G528), M492 (≠ C529), V493 (≠ I530)
Sites not aligning to the query:
6delA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide chlorimuron ethyl (see paper)
25% identity, 72% coverage: 59:534/657 of query aligns to 27:497/597 of 6delA
- active site: Y33 (≠ H65), G35 (vs. gap), G36 (= G66), A37 (≠ N67), I38 (≠ V68), E59 (= E90), T82 (= T113), F121 (≠ L154), Q122 (= Q155), E123 (≠ Q156), K171 (≠ Q213), K228 (≠ D272), M264 (≠ V308), V291 (≠ T335), V407 (≠ A444), L432 (≠ Y469), G433 (≠ S470), M435 (= M472), D460 (= D497), N487 (= N524), E489 (≠ G526), Q490 (≠ Y527), M492 (≠ C529), V493 (≠ I530), W496 (≠ L533)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: D289 (= D333), R290 (≠ F334), W496 (≠ L533)
- binding flavin-adenine dinucleotide: R161 (≠ L203), G217 (= G262), A218 (≠ G263), G219 (= G264), N222 (≠ Y267), T244 (= T288), L245 (≠ Q289), Q246 (≠ A290), L262 (= L306), G284 (= G328), A285 (≠ T329), R286 (= R330), D288 (≠ Q332), R290 (≠ F334), V291 (≠ T335), E317 (vs. gap), I318 (≠ V350), N322 (≠ A354), D336 (= D368), V337 (≠ A369), M412 (≠ L454), G430 (≠ Y467)
- binding (3Z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl](formyl)amino}-3-sulfanylpent-3-en-1-yl trihydrogen diphosphate: V407 (≠ A444), G408 (= G445), Q409 (≠ T446), H410 (= H452), G433 (≠ S470), M435 (= M472), G459 (= G496), D460 (= D497), A461 (≠ G498), S462 (= S499), M465 (= M502), N487 (= N524), E489 (≠ G526), Q490 (≠ Y527), G491 (= G528), M492 (≠ C529), V493 (≠ I530)
- binding magnesium ion: D460 (= D497), N487 (= N524), E489 (≠ G526)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (≠ A444), G408 (= G445), Q409 (≠ T446), H410 (= H452), G433 (≠ S470), M435 (= M472), G459 (= G496), D460 (= D497), A461 (≠ G498), S462 (= S499), M465 (= M502), N487 (= N524), E489 (≠ G526), Q490 (≠ Y527), G491 (= G528), M492 (≠ C529), V493 (≠ I530)
Sites not aligning to the query:
6denA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide iodomuron ethyl (see paper)
25% identity, 72% coverage: 59:534/657 of query aligns to 29:499/599 of 6denA
- active site: Y35 (≠ H65), G37 (vs. gap), G38 (= G66), A39 (≠ N67), I40 (≠ V68), E61 (= E90), T84 (= T113), F123 (≠ L154), Q124 (= Q155), E125 (≠ Q156), K173 (≠ Q213), K230 (≠ D272), M266 (≠ V308), V293 (≠ T335), V409 (≠ A444), L434 (≠ Y469), G435 (≠ S470), M437 (= M472), D462 (= D497), N489 (= N524), E491 (≠ G526), Q492 (≠ Y527), M494 (≠ C529), V495 (≠ I530), W498 (≠ L533)
- binding flavin-adenine dinucleotide: R163 (≠ L203), G219 (= G262), A220 (≠ G263), G221 (= G264), N224 (≠ Y267), T246 (= T288), L247 (≠ Q289), Q248 (≠ A290), L264 (= L306), G286 (= G328), A287 (≠ T329), R288 (= R330), D290 (≠ Q332), R292 (≠ F334), V293 (≠ T335), E319 (vs. gap), I320 (≠ V350), N324 (≠ A354), D338 (= D368), V339 (≠ A369), M414 (≠ L454), G432 (≠ Y467)
- binding ethyl 2-{[(4-iodo-6-methoxypyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: M266 (≠ V308), D291 (= D333), R292 (≠ F334), W498 (≠ L533)
- binding magnesium ion: D462 (= D497), N489 (= N524), E491 (≠ G526)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V409 (≠ A444), G410 (= G445), Q411 (≠ T446), H412 (= H452), G435 (≠ S470), M437 (= M472), G461 (= G496), D462 (= D497), A463 (≠ G498), S464 (= S499), N489 (= N524), E491 (≠ G526), Q492 (≠ Y527), G493 (= G528), M494 (≠ C529), V495 (≠ I530)
Sites not aligning to the query:
6derA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide metosulam (see paper)
25% identity, 72% coverage: 59:534/657 of query aligns to 29:500/600 of 6derA
- active site: Y35 (≠ H65), G37 (vs. gap), G38 (= G66), A39 (≠ N67), I40 (≠ V68), E61 (= E90), T84 (= T113), F123 (≠ L154), Q124 (= Q155), E125 (≠ Q156), K173 (≠ Q213), K231 (≠ D272), M267 (≠ V308), V294 (≠ T335), V410 (≠ A444), L435 (≠ Y469), G436 (≠ S470), M438 (= M472), D463 (= D497), N490 (= N524), E492 (≠ G526), Q493 (≠ Y527), M495 (≠ C529), V496 (≠ I530), W499 (≠ L533)
- binding flavin-adenine dinucleotide: R163 (≠ L203), G220 (= G262), A221 (≠ G263), G222 (= G264), N225 (≠ Y267), T247 (= T288), L248 (≠ Q289), Q249 (≠ A290), L265 (= L306), H268 (≠ T309), G287 (= G328), A288 (≠ T329), R289 (= R330), D291 (≠ Q332), R293 (≠ F334), V294 (≠ T335), E320 (vs. gap), I321 (≠ V350), N325 (≠ A354), G338 (≠ A367), D339 (= D368), V340 (≠ A369), Q414 (≠ K453), M415 (≠ L454), G433 (≠ Y467)
- binding Metosulam: R293 (≠ F334), M495 (≠ C529), W499 (≠ L533)
- binding magnesium ion: D463 (= D497), N490 (= N524), E492 (≠ G526)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V410 (≠ A444), G411 (= G445), Q412 (≠ T446), H413 (= H452), G436 (≠ S470), M438 (= M472), G462 (= G496), D463 (= D497), A464 (≠ G498), S465 (= S499), N490 (= N524), E492 (≠ G526), Q493 (≠ Y527), G494 (= G528), M495 (≠ C529), V496 (≠ I530)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V410 (≠ A444), G411 (= G445), Q412 (≠ T446), H413 (= H452), G436 (≠ S470), M438 (= M472), G462 (= G496), D463 (= D497), A464 (≠ G498), S465 (= S499), M468 (= M502), N490 (= N524), E492 (≠ G526), Q493 (≠ Y527), G494 (= G528), V496 (≠ I530)
Sites not aligning to the query:
6desA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide propoxycarbazone (see paper)
25% identity, 72% coverage: 59:534/657 of query aligns to 27:498/598 of 6desA
- active site: Y33 (≠ H65), G35 (vs. gap), G36 (= G66), A37 (≠ N67), I38 (≠ V68), E59 (= E90), T82 (= T113), F121 (≠ L154), Q122 (= Q155), E123 (≠ Q156), K171 (≠ Q213), K229 (≠ D272), M265 (≠ V308), V292 (≠ T335), V408 (≠ A444), L433 (≠ Y469), G434 (≠ S470), M436 (= M472), D461 (= D497), N488 (= N524), E490 (≠ G526), Q491 (≠ Y527), M493 (≠ C529), V494 (≠ I530), W497 (≠ L533)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: M265 (≠ V308), D290 (= D333), R291 (≠ F334), W497 (≠ L533)
- binding flavin-adenine dinucleotide: R161 (≠ L203), G218 (= G262), A219 (≠ G263), G220 (= G264), N223 (≠ Y267), T245 (= T288), L246 (≠ Q289), Q247 (≠ A290), L263 (= L306), G285 (= G328), A286 (≠ T329), R287 (= R330), D289 (≠ Q332), R291 (≠ F334), V292 (≠ T335), E318 (vs. gap), I319 (≠ V350), N323 (≠ A354), D337 (= D368), V338 (≠ A369), Q412 (≠ K453), M413 (≠ L454), G431 (≠ Y467)
- binding magnesium ion: D461 (= D497), N488 (= N524), E490 (≠ G526)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V408 (≠ A444), G409 (= G445), Q410 (≠ T446), H411 (= H452), G434 (≠ S470), M436 (= M472), G460 (= G496), D461 (= D497), A462 (≠ G498), S463 (= S499), N488 (= N524), E490 (≠ G526), Q491 (≠ Y527), G492 (= G528), M493 (≠ C529), V494 (≠ I530)
Sites not aligning to the query:
6depA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide sulfometuron methyl (see paper)
25% identity, 72% coverage: 59:534/657 of query aligns to 27:498/598 of 6depA
- active site: Y33 (≠ H65), G35 (vs. gap), G36 (= G66), A37 (≠ N67), I38 (≠ V68), E59 (= E90), T82 (= T113), F121 (≠ L154), Q122 (= Q155), E123 (≠ Q156), K171 (≠ Q213), K229 (≠ D272), M265 (≠ V308), V292 (≠ T335), V408 (≠ A444), L433 (≠ Y469), G434 (≠ S470), M436 (= M472), D461 (= D497), N488 (= N524), E490 (≠ G526), Q491 (≠ Y527), M493 (≠ C529), V494 (≠ I530), W497 (≠ L533)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D290 (= D333), R291 (≠ F334), M493 (≠ C529), W497 (≠ L533)
- binding flavin-adenine dinucleotide: R161 (≠ L203), G218 (= G262), A219 (≠ G263), G220 (= G264), N223 (≠ Y267), T245 (= T288), L246 (≠ Q289), Q247 (≠ A290), L263 (= L306), G264 (= G307), G285 (= G328), A286 (≠ T329), R287 (= R330), D289 (≠ Q332), R291 (≠ F334), V292 (≠ T335), E318 (vs. gap), I319 (≠ V350), N323 (≠ A354), D337 (= D368), V338 (≠ A369), M413 (≠ L454), G431 (≠ Y467)
- binding magnesium ion: D461 (= D497), N488 (= N524), E490 (≠ G526)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V408 (≠ A444), G409 (= G445), Q410 (≠ T446), H411 (= H452), G434 (≠ S470), M436 (= M472), G460 (= G496), D461 (= D497), A462 (≠ G498), S463 (= S499), M466 (= M502), N488 (= N524), E490 (≠ G526), Q491 (≠ Y527), G492 (= G528), M493 (≠ C529), V494 (≠ I530)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V408 (≠ A444), G409 (= G445), Q410 (≠ T446), H411 (= H452), G434 (≠ S470), M436 (= M472), G460 (= G496), D461 (= D497), A462 (≠ G498), S463 (= S499), M466 (= M502), N488 (= N524), E490 (≠ G526), Q491 (≠ Y527), G492 (= G528), M493 (≠ C529), V494 (≠ I530)
Sites not aligning to the query:
6deoA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide iodomuron methyl (see paper)
25% identity, 72% coverage: 59:534/657 of query aligns to 25:493/593 of 6deoA
- active site: Y31 (≠ H65), G33 (vs. gap), G34 (= G66), A35 (≠ N67), I36 (≠ V68), E57 (= E90), T80 (= T113), F119 (≠ L154), Q120 (= Q155), E121 (≠ Q156), K169 (≠ Q213), K224 (≠ D272), M260 (≠ V308), V287 (≠ T335), V403 (≠ A444), L428 (≠ Y469), G429 (≠ S470), M431 (= M472), D456 (= D497), N483 (= N524), E485 (≠ G526), Q486 (≠ Y527), M488 (≠ C529), V489 (≠ I530), W492 (≠ L533)
- binding flavin-adenine dinucleotide: R159 (≠ L203), G213 (= G262), A214 (≠ G263), G215 (= G264), N218 (≠ Y267), T240 (= T288), L241 (≠ Q289), Q242 (≠ A290), L258 (= L306), G280 (= G328), A281 (≠ T329), R282 (= R330), D284 (≠ Q332), R286 (≠ F334), V287 (≠ T335), E313 (vs. gap), I314 (≠ V350), N318 (≠ A354), D332 (= D368), V333 (≠ A369), M408 (≠ L454), G426 (≠ Y467)
- binding methyl 2-{[(4-iodo-6-methoxypyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: M260 (≠ V308), D285 (= D333), R286 (≠ F334), M488 (≠ C529), W492 (≠ L533)
- binding magnesium ion: D456 (= D497), N483 (= N524), E485 (≠ G526)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V403 (≠ A444), G404 (= G445), Q405 (≠ T446), H406 (= H452), G429 (≠ S470), M431 (= M472), G455 (= G496), D456 (= D497), A457 (≠ G498), S458 (= S499), M461 (= M502), N483 (= N524), E485 (≠ G526), Q486 (≠ Y527), G487 (= G528), M488 (≠ C529), V489 (≠ I530)
Sites not aligning to the query:
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
24% identity, 78% coverage: 89:599/657 of query aligns to 140:636/667 of P09342
- C161 (≠ M110) modified: Disulfide link with 307
- P194 (≠ F145) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ L265) modified: Disulfide link with 161
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
24% identity, 78% coverage: 89:599/657 of query aligns to 137:633/664 of P09114
- P191 (≠ F145) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (≠ L533) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
6lpiB Crystal structure of ahas holo-enzyme (see paper)
25% identity, 77% coverage: 28:534/657 of query aligns to 5:465/539 of 6lpiB
- active site: I27 (≠ F63), G29 (≠ H65), G30 (= G66), S31 (≠ N67), I32 (≠ V68), E53 (≠ N89), C76 (≠ S115), F115 (≠ L154), Q116 (= Q155), E117 (≠ Q156), K165 (≠ Q213), M256 (≠ V308), A283 (≠ T335), V375 (≠ A444), G401 (≠ S470), M403 (= M472), D428 (= D497), N455 (= N524), A457 (≠ G526), L458 (≠ Y527), L460 (≠ C529), V461 (≠ I530), Q464 (≠ L533)
- binding flavin-adenine dinucleotide: R155 (≠ L203), G212 (= G262), G213 (= G263), G214 (= G264), T236 (= T288), L237 (≠ Q289), M238 (≠ A290), L254 (= L306), M256 (≠ V308), H257 (≠ T309), G276 (= G328), A277 (≠ T329), R278 (= R330), D280 (≠ Q332), R282 (≠ F334), A283 (≠ T335), D300 (≠ N351), I301 (≠ A352), D319 (= D368), V320 (≠ A369), M380 (≠ L454), G398 (≠ Y467)
- binding magnesium ion: D428 (= D497), N455 (= N524)
- binding thiamine diphosphate: E53 (≠ N89), C76 (≠ S115), P79 (= P118), G376 (= G445), Q377 (≠ T446), H378 (= H452), G401 (≠ S470), M403 (= M472), G427 (= G496), D428 (= D497), G429 (= G498), S430 (= S499), M433 (= M502), N455 (= N524), A457 (≠ G526), L458 (≠ Y527), G459 (= G528), L460 (≠ C529), V461 (≠ I530)
8beoB Crystal structure of e. Coli glyoxylate carboligase mutant i393a with map
26% identity, 78% coverage: 85:599/657 of query aligns to 45:548/592 of 8beoB
- binding methyl hydrogen (s)-acetylphosphonate: C490 (= C537), Q492 (≠ G539)
- binding flavin-adenine dinucleotide: R153 (≠ L203), P154 (≠ C204), G210 (= G262), G211 (= G263), G212 (= G264), N215 (≠ Y267), T236 (= T288), L237 (≠ Q289), M238 (≠ A290), V254 (≠ L306), G255 (= G307), Q257 (vs. gap), T258 (= T309), G277 (= G328), N278 (≠ T329), R279 (= R330), A281 (≠ Q332), R283 (≠ F334), H284 (≠ T335), D301 (vs. gap), I302 (≠ V350), Q306 (≠ A354), D320 (= D368), A321 (= A369), G415 (vs. gap)
- binding magnesium ion: D445 (= D497), F450 (≠ M502), L451 (≠ M503), E453 (≠ S505), N472 (= N524), Y474 (≠ G526)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-{(1s)-1-hydroxy-1-[(r)-hydroxy(methoxy)phosphoryl]ethyl}-5-(2-{[(s)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: R283 (≠ F334), G393 (≠ E450), L394 (= L451), S395 (≠ H452), L420 (≠ M472), G444 (= G496), D445 (= D497), F446 (≠ G498), D447 (≠ S499), N472 (= N524), Y474 (≠ G526), L475 (≠ Y527), G476 (= G528), L477 (≠ C529), I478 (= I530)
- binding 2,3-dimethoxy-5-methyl-1,4-benzoquinone: Q352 (≠ R401), R356 (≠ S405)
Sites not aligning to the query:
8beoA Crystal structure of e. Coli glyoxylate carboligase mutant i393a with map
26% identity, 78% coverage: 85:599/657 of query aligns to 45:548/592 of 8beoA
- binding flavin-adenine dinucleotide: R153 (≠ L203), P154 (≠ C204), G210 (= G262), G211 (= G263), G212 (= G264), N215 (≠ Y267), T236 (= T288), L237 (≠ Q289), M238 (≠ A290), V254 (≠ L306), G255 (= G307), Q257 (vs. gap), T258 (= T309), G277 (= G328), N278 (≠ T329), R279 (= R330), A281 (≠ Q332), R283 (≠ F334), H284 (≠ T335), D301 (vs. gap), I302 (≠ V350), Q306 (≠ A354), D320 (= D368), A321 (= A369), I397 (≠ L454), G415 (vs. gap)
- binding magnesium ion: R384 (≠ S433), V405 (≠ A462), F406 (≠ Y463), H410 (≠ Y467), D445 (= D497), F450 (≠ M502), L451 (≠ M503), E453 (≠ S505), N472 (= N524), Y474 (≠ G526)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-{(1s)-1-hydroxy-1-[(r)-hydroxy(methoxy)phosphoryl]ethyl}-5-(2-{[(s)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: R283 (≠ F334), G393 (≠ E450), L394 (= L451), S395 (≠ H452), L420 (≠ M472), G444 (= G496), D445 (= D497), F446 (≠ G498), D447 (≠ S499), N472 (= N524), Y474 (≠ G526), L475 (≠ Y527), G476 (= G528), L477 (≠ C529), I478 (= I530)
- binding 2,3-dimethoxy-5-methyl-1,4-benzoquinone: E248 (≠ P300), Q352 (≠ R401)
Sites not aligning to the query:
8i01A Crystal structure of escherichia coli glyoxylate carboligase
26% identity, 78% coverage: 85:599/657 of query aligns to 47:550/594 of 8i01A
- binding flavin-adenine dinucleotide: R155 (≠ L203), G212 (= G262), G213 (= G263), G214 (= G264), N217 (≠ Y267), T238 (= T288), L239 (≠ Q289), M240 (≠ A290), V256 (≠ L306), G257 (= G307), Q259 (vs. gap), T260 (= T309), G279 (= G328), N280 (≠ T329), R281 (= R330), A283 (≠ Q332), R285 (≠ F334), H286 (≠ T335), D303 (vs. gap), I304 (≠ V350), Q308 (≠ A354), D322 (= D368), A323 (= A369), G417 (vs. gap)
- binding magnesium ion: D447 (= D497), F452 (≠ M502), E455 (≠ S505), N474 (= N524), Y476 (≠ G526)
- binding thiamine diphosphate: G395 (≠ E450), L396 (= L451), S397 (≠ H452), L422 (≠ M472), G446 (= G496), D447 (= D497), F448 (≠ G498), D449 (≠ S499), N474 (= N524), Y476 (≠ G526), L477 (≠ Y527), G478 (= G528), L479 (≠ C529), I480 (= I530)
- binding 2,3-dimethoxy-5-methyl-1,4-benzoquinone: Q354 (≠ R401), C492 (= C537), Q494 (≠ G539)
Sites not aligning to the query:
8i07D Crystal structure of escherichia coli glyoxylate carboligase double mutant in complex with glycolaldehyde
26% identity, 78% coverage: 85:599/657 of query aligns to 47:550/594 of 8i07D
- binding 2-oxidanylethanal: R285 (≠ F334), I480 (= I530)
- binding flavin-adenine dinucleotide: R155 (≠ L203), P156 (≠ C204), G212 (= G262), G213 (= G263), G214 (= G264), N217 (≠ Y267), T238 (= T288), L239 (≠ Q289), M240 (≠ A290), V256 (≠ L306), G257 (= G307), Q259 (vs. gap), T260 (= T309), G279 (= G328), N280 (≠ T329), R281 (= R330), R285 (≠ F334), H286 (≠ T335), D303 (vs. gap), I304 (≠ V350), Q308 (≠ A354), D322 (= D368), A323 (= A369), I399 (≠ L454), G417 (vs. gap)
- binding magnesium ion: D447 (= D497), F452 (≠ M502), L453 (≠ M503), E455 (≠ S505), N474 (= N524), Y476 (≠ G526)
- binding thiamine diphosphate: V52 (≠ E90), T76 (= T114), G395 (≠ E450), L396 (= L451), S397 (≠ H452), L422 (≠ M472), G446 (= G496), D447 (= D497), F448 (≠ G498), D449 (≠ S499), N474 (= N524), Y476 (≠ G526), L477 (≠ Y527), G478 (= G528), L479 (≠ C529), I480 (= I530)
- binding ubiquinone-1: Q354 (≠ R401), R358 (≠ S405), C492 (= C537), Q494 (≠ G539)
Sites not aligning to the query:
1n0hA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorimuron ethyl (see paper)
24% identity, 83% coverage: 59:602/657 of query aligns to 25:558/599 of 1n0hA
- active site: Y31 (≠ H65), G33 (vs. gap), G34 (= G66), A35 (≠ N67), I36 (≠ V68), E57 (= E90), T80 (= T113), F119 (≠ L154), Q120 (= Q155), E121 (≠ Q156), K169 (≠ Q213), R230 (≠ D272), M266 (≠ V308), V293 (≠ T335), V409 (≠ A444), L434 (≠ Y469), G435 (≠ S470), M437 (= M472), D462 (= D497), N489 (= N524), E491 (≠ G526), Q492 (≠ Y527), M494 (≠ C529), V495 (≠ I530), W498 (≠ L533), L520 (≠ H564), G525 (= G569), L526 (≠ A570)
- binding 4-{[(4'-amino-2'-methylpyrimidin-5'-yl)methyl]amino}pent-3-enyl diphosphate: V409 (≠ A444), G410 (= G445), Q411 (≠ T446), H412 (vs. gap), G435 (≠ S470), M437 (= M472), G461 (= G496), D462 (= D497), A463 (≠ G498), S464 (= S499), M467 (= M502), N489 (= N524), E491 (≠ G526), Q492 (≠ Y527), G493 (= G528), V495 (≠ I530)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: G34 (= G66), A35 (≠ N67), V109 (≠ I144), P110 (≠ F145), F119 (≠ L154), K169 (≠ Q213), M266 (≠ V308), D291 (= D333), R292 (≠ F334), V495 (≠ I530), W498 (≠ L533)
- binding flavin-adenine dinucleotide: R159 (≠ L203), G219 (= G262), A220 (≠ G263), G221 (= G264), N224 (vs. gap), T246 (= T288), L247 (≠ Q289), Q248 (≠ A290), L264 (= L306), G265 (= G307), M266 (≠ V308), H267 (≠ T309), G286 (= G328), A287 (≠ T329), R288 (= R330), D290 (≠ Q332), R292 (≠ F334), V293 (≠ T335), E319 (≠ A349), V320 (= V350), N324 (≠ A354), G337 (≠ A367), D338 (= D368), A339 (= A369), M414 (≠ L447), G432 (≠ Y467), G433 (= G468)
- binding magnesium ion: D462 (= D497), N489 (= N524), E491 (≠ G526)
- binding thiamine diphosphate: Y31 (≠ H65), E57 (= E90), P83 (= P118)
Sites not aligning to the query:
1t9cA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
24% identity, 83% coverage: 59:602/657 of query aligns to 23:555/596 of 1t9cA
- active site: Y29 (≠ H65), G31 (vs. gap), G32 (= G66), A33 (≠ N67), I34 (≠ V68), E55 (= E90), T78 (= T113), F117 (≠ L154), Q118 (= Q155), E119 (≠ Q156), K167 (≠ Q213), R227 (≠ D272), M263 (≠ V308), V290 (≠ T335), V406 (≠ A444), L431 (≠ Y469), G432 (≠ S470), M434 (= M472), D459 (= D497), N486 (= N524), E488 (≠ G526), Q489 (≠ Y527), M491 (≠ C529), V492 (≠ I530), W495 (≠ L533), L517 (≠ H564), G522 (= G569), L523 (≠ A570)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G66), V107 (≠ I144), P108 (≠ F145), F117 (≠ L154), K167 (≠ Q213), D288 (= D333), R289 (≠ F334), W495 (≠ L533)
- binding flavin-adenine dinucleotide: R157 (≠ L203), G216 (= G262), A217 (≠ G263), G218 (= G264), N221 (vs. gap), T243 (= T288), L244 (≠ Q289), Q245 (≠ A290), L261 (= L306), M263 (≠ V308), H264 (≠ T309), G283 (= G328), A284 (≠ T329), R285 (= R330), D287 (≠ Q332), R289 (≠ F334), V290 (≠ T335), E316 (≠ A349), V317 (= V350), N321 (≠ A354), G334 (≠ A367), D335 (= D368), A336 (= A369), M411 (≠ L447), G429 (≠ Y467), G430 (= G468)
- binding magnesium ion: D459 (= D497), N486 (= N524), E488 (≠ G526)
Sites not aligning to the query:
1t9aA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
24% identity, 83% coverage: 59:602/657 of query aligns to 24:556/597 of 1t9aA
- active site: Y30 (≠ H65), G32 (vs. gap), G33 (= G66), A34 (≠ N67), I35 (≠ V68), E56 (= E90), T79 (= T113), F118 (≠ L154), Q119 (= Q155), E120 (≠ Q156), K168 (≠ Q213), R228 (≠ D272), M264 (≠ V308), V291 (≠ T335), V407 (≠ A444), L432 (≠ Y469), G433 (≠ S470), M435 (= M472), D460 (= D497), N487 (= N524), E489 (≠ G526), Q490 (≠ Y527), M492 (≠ C529), V493 (≠ I530), W496 (≠ L533), L518 (≠ H564), G523 (= G569), L524 (≠ A570)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: G33 (= G66), V108 (≠ I144), P109 (≠ F145), F118 (≠ L154), K168 (≠ Q213), M264 (≠ V308), D289 (= D333), R290 (≠ F334), M492 (≠ C529), V493 (≠ I530), W496 (≠ L533)
- binding flavin-adenine dinucleotide: R158 (≠ L203), G217 (= G262), A218 (≠ G263), G219 (= G264), N222 (vs. gap), T244 (= T288), L245 (≠ Q289), Q246 (≠ A290), L262 (= L306), M264 (≠ V308), H265 (≠ T309), G284 (= G328), A285 (≠ T329), R286 (= R330), D288 (≠ Q332), R290 (≠ F334), V291 (≠ T335), E317 (≠ A349), V318 (= V350), N322 (≠ A354), G335 (≠ A367), D336 (= D368), A337 (= A369), Q411 (vs. gap), M412 (≠ L447), G430 (≠ Y467), G431 (= G468)
- binding magnesium ion: D460 (= D497), N487 (= N524), E489 (≠ G526)
- binding propyl trihydrogen diphosphate: V407 (≠ A444), G408 (= G445), Q409 (≠ T446), H410 (vs. gap), M435 (= M472), G459 (= G496), D460 (= D497), A461 (≠ G498), S462 (= S499), N487 (= N524), E489 (≠ G526), Q490 (≠ Y527), G491 (= G528), M492 (≠ C529)
- binding 5-{[ethyl(methyl)amino]methyl}-2-methyl-5,6-dihydropyrimidin-4-amine: G433 (≠ S470), M435 (= M472), M465 (= M502)
Sites not aligning to the query:
1t9dA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
24% identity, 83% coverage: 59:602/657 of query aligns to 23:555/596 of 1t9dA
- active site: Y29 (≠ H65), G31 (vs. gap), G32 (= G66), A33 (≠ N67), I34 (≠ V68), E55 (= E90), T78 (= T113), F117 (≠ L154), Q118 (= Q155), E119 (≠ Q156), K167 (≠ Q213), R227 (≠ D272), M263 (≠ V308), V290 (≠ T335), V406 (≠ A444), L431 (≠ Y469), G432 (≠ S470), M434 (= M472), D459 (= D497), N486 (= N524), E488 (≠ G526), Q489 (≠ Y527), M491 (≠ C529), V492 (≠ I530), W495 (≠ L533), L517 (≠ H564), G522 (= G569), L523 (≠ A570)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G66), A33 (≠ N67), V107 (≠ I144), P108 (≠ F145), F117 (≠ L154), K167 (≠ Q213), M263 (≠ V308), D288 (= D333), R289 (≠ F334), W495 (≠ L533)
- binding flavin-adenine dinucleotide: R157 (≠ L203), G216 (= G262), A217 (≠ G263), G218 (= G264), N221 (vs. gap), T243 (= T288), L244 (≠ Q289), Q245 (≠ A290), M260 (≠ A305), L261 (= L306), H264 (≠ T309), G283 (= G328), A284 (≠ T329), R285 (= R330), D287 (≠ Q332), R289 (≠ F334), V290 (≠ T335), E316 (≠ A349), V317 (= V350), N321 (≠ A354), G334 (≠ A367), D335 (= D368), A336 (= A369), Q410 (vs. gap), M411 (≠ L447), G429 (≠ Y467), G430 (= G468)
- binding magnesium ion: D459 (= D497), N486 (= N524), E488 (≠ G526)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E55 (= E90), P81 (= P118), Q118 (= Q155), G432 (≠ S470), M434 (= M472), M464 (= M502)
Sites not aligning to the query:
7pt4B Actinobacterial 2-hydroxyacyl-coa lyase (achacl) structure in complex with a covalently bound reaction intermediate as well as products formyl-coa and acetone (see paper)
26% identity, 84% coverage: 58:610/657 of query aligns to 19:549/584 of 7pt4B
- binding magnesium ion: D446 (= D497), N473 (= N524), A475 (≠ G526)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-{(1r,11r,15s,17r)-19-[(2r,3s,4r,5r)-5-(6-amino-9h-purin-9-yl)-4-hydroxy-3-(phosphonooxy)tetrahydrofuran-2-yl]-1,11,15,17-tetrahydroxy-12,12-dimethyl-15,17-dioxido-6,10-dioxo-14,16,18-trioxa-2-thia-5,9-diaza-15,17-diphosphanonadec-1-yl}-5-(2-{[(r)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: S257 (≠ A305), R259 (≠ A314), S260 (≠ N315), Q279 (≠ D333), Y352 (vs. gap), G395 (≠ L451), G396 (≠ H452), D397 (≠ K453), L398 (= L454), L399 (≠ W455), R403 (≠ K459), L404 (≠ P460), G419 (≠ S470), L421 (≠ M472), G445 (= G496), D446 (= D497), G447 (= G498), A448 (≠ S499), N473 (= N524), A475 (≠ G526), W476 (≠ Y527), N477 (≠ G528), I478 (= I530), E479 (≠ N531), D547 (= D608)
Sites not aligning to the query:
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-{(1r,11r,15s,17r)-19-[(2r,3s,4r,5r)-5-(6-amino-9h-purin-9-yl)-4-hydroxy-3-(phosphonooxy)tetrahydrofuran-2-yl]-1,11,15,17-tetrahydroxy-12,12-dimethyl-15,17-dioxido-6,10-dioxo-14,16,18-trioxa-2-thia-5,9-diaza-15,17-diphosphanonadec-1-yl}-5-(2-{[(r)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: 561
1t9bB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
24% identity, 83% coverage: 59:602/657 of query aligns to 23:554/595 of 1t9bB
- active site: Y29 (≠ H65), G31 (vs. gap), G32 (= G66), A33 (≠ N67), I34 (≠ V68), E55 (= E90), T78 (= T113), F117 (≠ L154), Q118 (= Q155), E119 (≠ Q156), K167 (≠ Q213), R226 (≠ D272), M262 (≠ V308), V289 (≠ T335), V405 (≠ A444), L430 (≠ Y469), G431 (≠ S470), M433 (= M472), D458 (= D497), N485 (= N524), E487 (≠ G526), Q488 (≠ Y527), M490 (≠ C529), V491 (≠ I530), W494 (≠ L533), L516 (≠ H564), G521 (= G569), L522 (≠ A570)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (≠ I144), P108 (≠ F145), D287 (= D333), R288 (≠ F334), M490 (≠ C529), W494 (≠ L533)
- binding flavin-adenine dinucleotide: R157 (≠ L203), G215 (= G262), A216 (≠ G263), G217 (= G264), N220 (vs. gap), T242 (= T288), L243 (≠ Q289), Q244 (≠ A290), M259 (≠ A305), L260 (= L306), M262 (≠ V308), H263 (≠ T309), G282 (= G328), A283 (≠ T329), R284 (= R330), D286 (≠ Q332), R288 (≠ F334), V289 (≠ T335), E315 (≠ A349), V316 (= V350), N320 (≠ A354), G333 (≠ A367), D334 (= D368), A335 (= A369), Q409 (vs. gap), M410 (≠ L447), G428 (≠ Y467), G429 (= G468)
- binding magnesium ion: D458 (= D497), N485 (= N524), E487 (≠ G526)
Sites not aligning to the query:
Query Sequence
>BPHYT_RS13915 FitnessBrowser__BFirm:BPHYT_RS13915
MNQRVVHHEAASANDASHASTRTDGTVRLTTAQALVRYLAAQRVATEDGEGTEPLFGGVF
AIFGHGNVAGIGEALYQHREELPTLRAHNEQAMAHSAIAYAKAHFRRRMMAVTTSIGPGA
TNLVTAAALAHVNRLPVLLLPGDIFVSRAPDPVLQQVEDFHDGGVSANDALKPVSRYFDR
IVHPAQLLNALPRAVRVLTDAALCGPVTLALPQDVQAQAWDFPVDFFKPRVVTFYSPAPR
ADEIEAAIARLRHAKRPLIVAGGGLLYGRATDALHRFATTHGIPVAETQAGKGALAWNDP
LNAGALGVTGSPAANALAHDADCVLAIGTRLQDFTTGSNTLFTQADVIAVNANAFDGLKQ
RAQVVEADARLALEALAEPLQGWHADRAWTARAHKLAASWRDTVSTLTHAPQRDTVLPYE
GDVIGAVQRSSASSPTNDIVVCAAGTLPAELHKLWRAGKPGAYHVEYGYSCMGYEIAGGL
GVKLARPAREVIVMVGDGSYLMMNSEIATSVMIGAKLIVVVLDNRGYGCINRLQQACGGA
PFNNLLENCMQGPLGAPKIDFAAHARALGAQAEHAANVAELAAALQRARAADRTYVISID
TDPAHTTDEGGWWWEVAVPEVSTRPAVRDARAKYETQLAARAEPAGSAQNTGSTDNE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory