SitesBLAST
Comparing BPHYT_RS14155 FitnessBrowser__BFirm:BPHYT_RS14155 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P31120 Phosphoglucosamine mutase; EC 5.4.2.10 from Escherichia coli (strain K12) (see 3 papers)
57% identity, 99% coverage: 3:448/452 of query aligns to 4:443/445 of P31120
- S100 (= S106) mutation to A: 2% of wild-type activity.; mutation to T: 20-fold increase in the non-specific phosphoglucomutase activity towards glucose-phosphate substrates (non aminated).
- S102 (= S108) active site, Phosphoserine intermediate; modified: Phosphoserine; by autocatalysis; mutation to A: Loss of activity in the absence or presence of glucosamine-1,6-diP.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7omlA Bacillus subtilis phosphoglucomutase glmm (metal bound) (see paper)
43% identity, 98% coverage: 4:448/452 of query aligns to 2:441/445 of 7omlA
7ojrA Bacillus subtilis phosphoglucomutase glmm (phosphate bound) (see paper)
43% identity, 98% coverage: 4:448/452 of query aligns to 2:441/445 of 7ojrA
3i3wA Structure of a phosphoglucosamine mutase from francisella tularensis
42% identity, 99% coverage: 4:449/452 of query aligns to 1:438/441 of 3i3wA
- active site: R9 (= R12), S99 (= S108), H100 (= H109), K109 (= K118), D237 (= D247), D239 (= D249), D241 (= D251), R242 (= R252), H324 (= H335)
- binding zinc ion: S99 (= S108), D237 (= D247), D239 (= D249), D241 (= D251)
1wqaA Crystal structure of pyrococcus horikoshii phosphomannomutase/phosphoglucomutase complexed with mg2+
33% identity, 96% coverage: 4:439/452 of query aligns to 3:442/455 of 1wqaA
- active site: R11 (= R12), S101 (= S108), H102 (= H109), K111 (= K118), D243 (= D247), D245 (= D249), D247 (= D251), R248 (= R252), G330 (≠ H335), R340 (vs. gap)
- binding magnesium ion: S101 (= S108), D243 (= D247), D245 (= D249), D247 (= D251)
P26276 Phosphomannomutase/phosphoglucomutase; PMM / PGM; EC 5.4.2.2; EC 5.4.2.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 10 papers)
29% identity, 93% coverage: 11:432/452 of query aligns to 19:437/463 of P26276
- R20 (= R12) mutation to A: No phosphoglucomutase activity.
- S108 (= S108) binding via phosphate group; modified: Phosphoserine; mutation S->A,V: About 5% activity, still subject to substrate inhibition and requires G1,6P as an activator; phosphorylation occurs at a different site.; mutation to C: KM for G1P unchanged, kcat decreases 24-fold; G1,6P stimulates reaction by 2-3 orders of magnitude. No stable protein phosphorylation detected, altered ligation of metal residue.
- N110 (= N110) mutation to A: KM halves, decreases processivity as dissociation of G1,6P intermediate increases 30-fold.
- D242 (= D247) binding
- D244 (= D249) binding
- D246 (= D251) binding
- R247 (= R252) mutation to A: Small reduction in KM, small increase in dissociation of G1,6P intermediate.
- R262 (≠ E267) mutation to A: Increases KM 2-fold, decreases kcat 9-fold for G1P. Alters flexibility of the hinge region.
- K285 (≠ L290) binding
- H308 (≠ D314) binding ; binding
- E325 (= E331) mutation to A: Reduces KM and Vmax approximately 2-fold.
- EMSGH 325:329 (≠ EGSGH 331:335) binding ; binding
- H329 (= H335) mutation to A: No phosphoglucomutase activity using G1P as substrate, protein is less easily phosphorylated, no significant change in structure.
- P368 (= P376) mutation to G: Increases KM 2-fold, decreases kcat 6-fold for G1P. Alters flexibility of the hinge region, structure is less compact.
- R421 (= R416) mutation to C: Loss of phosphomannomutase activity, very low phosphoglucomutase activity.
- RASNT 421:425 (≠ RASGT 416:420) binding ; binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 15 R→A: KM halves, decreases processivity as dissociation of G1,6P intermediate increases 25-fold.
- 17 binding ; binding
Q02E40 Phosphomannomutase/phosphoglucomutase; PMM / PGM; EC 5.4.2.2; EC 5.4.2.8 from Pseudomonas aeruginosa (strain UCBPP-PA14) (see paper)
29% identity, 93% coverage: 11:432/452 of query aligns to 19:437/463 of Q02E40
- S108 (= S108) active site, Non-phosphorylated intermediate; modified: Phosphoserine
2h5aX Complex of the enzyme pmm/pgm with xylose 1-phosphate (see paper)
29% identity, 93% coverage: 11:432/452 of query aligns to 11:429/455 of 2h5aX
- active site: H101 (= H109), D234 (= D247), D236 (= D249), D238 (= D251), R239 (= R252), D332 (≠ G345)
- binding 1-O-phosphono-alpha-D-xylopyranose: T298 (≠ V312), G299 (= G313), H300 (≠ D314), E317 (= E331), S319 (= S333), H321 (= H335), R413 (= R416), S415 (= S418), N416 (≠ G419), T417 (= T420)
- binding zinc ion: S100 (= S108), D234 (= D247), D236 (= D249), D238 (= D251)
Sites not aligning to the query:
2h4lX Complex of pmm/pgm with ribose 1-phosphate (see paper)
29% identity, 93% coverage: 11:432/452 of query aligns to 11:429/455 of 2h4lX
- active site: H101 (= H109), D234 (= D247), D236 (= D249), D238 (= D251), R239 (= R252), D332 (≠ G345)
- binding 1-O-phosphono-alpha-D-ribofuranose: R12 (= R12), S100 (= S108), T298 (≠ V312), E317 (= E331), R413 (= R416), S415 (= S418), N416 (≠ G419), T417 (= T420)
- binding zinc ion: S100 (= S108), D234 (= D247), D236 (= D249), D238 (= D251)
Sites not aligning to the query:
2fkfA Phosphomannomutase/phosphoglucomutase from pseudomonas aeruginosa with alpha-d-glucose 1,6-bisphosphate bound (see paper)
29% identity, 93% coverage: 11:432/452 of query aligns to 11:429/455 of 2fkfA
- active site: R12 (= R12), S100 (= S108), H101 (= H109), K110 (= K118), D234 (= D247), D236 (= D249), D238 (= D251), R239 (= R252), H321 (= H335), D332 (≠ G345)
- binding 1,6-di-O-phosphono-alpha-D-glucopyranose: H101 (= H109), S319 (= S333), R413 (= R416), S415 (= S418), N416 (≠ G419), T417 (= T420)
- binding zinc ion: S100 (= S108), D234 (= D247), D236 (= D249), D238 (= D251)
Sites not aligning to the query:
1pcmX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
29% identity, 93% coverage: 11:432/452 of query aligns to 11:429/455 of 1pcmX
- active site: R12 (= R12), S100 (= S108), H101 (= H109), K110 (= K118), D234 (= D247), D236 (= D249), D238 (= D251), R239 (= R252), H321 (= H335), D332 (≠ G345)
- binding 6-O-phosphono-alpha-D-mannopyranose: S100 (= S108), T298 (≠ V312), G299 (= G313), H300 (≠ D314), E317 (= E331), S319 (= S333), H321 (= H335), R413 (= R416), S415 (= S418)
- binding zinc ion: S100 (= S108), D234 (= D247), D236 (= D249), D238 (= D251)
Sites not aligning to the query:
1p5gX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
29% identity, 93% coverage: 11:432/452 of query aligns to 11:429/455 of 1p5gX
- active site: R12 (= R12), S100 (= S108), H101 (= H109), K110 (= K118), D234 (= D247), D236 (= D249), D238 (= D251), R239 (= R252), H321 (= H335), D332 (≠ G345)
- binding 6-O-phosphono-alpha-D-glucopyranose: S100 (= S108), K277 (≠ L290), G299 (= G313), H300 (≠ D314), E317 (= E331), S319 (= S333), H321 (= H335), R413 (= R416), S415 (= S418), N416 (≠ G419), T417 (= T420)
- binding zinc ion: S100 (= S108), D234 (= D247), D236 (= D249), D238 (= D251)
Sites not aligning to the query:
1p5dX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
29% identity, 93% coverage: 11:432/452 of query aligns to 11:429/455 of 1p5dX
- active site: R12 (= R12), S100 (= S108), H101 (= H109), K110 (= K118), D234 (= D247), D236 (= D249), D238 (= D251), R239 (= R252), H321 (= H335), D332 (≠ G345)
- binding 1-O-phosphono-alpha-D-glucopyranose: S100 (= S108), R239 (= R252), T298 (≠ V312), G299 (= G313), H300 (≠ D314), E317 (= E331), S319 (= S333), H321 (= H335), R413 (= R416), S415 (= S418), T417 (= T420)
- binding zinc ion: S100 (= S108), D234 (= D247), D236 (= D249), D238 (= D251)
Sites not aligning to the query:
1pcjX Enzyme-ligand complex of p. Aeruginosa pmm/pgm (see paper)
29% identity, 93% coverage: 11:432/452 of query aligns to 14:432/458 of 1pcjX
- active site: R15 (= R12), S103 (= S108), H104 (= H109), K113 (= K118), D237 (= D247), D239 (= D249), D241 (= D251), R242 (= R252), H324 (= H335), D335 (≠ G345)
- binding 1-O-phosphono-alpha-D-mannopyranose: S103 (= S108), T301 (≠ V312), G302 (= G313), E320 (= E331), S322 (= S333), H324 (= H335), R416 (= R416), S418 (= S418), N419 (≠ G419), T420 (= T420)
- binding zinc ion: S103 (= S108), D237 (= D247), D239 (= D249), D241 (= D251)
Sites not aligning to the query:
1k2yX Crystal structure of phosphomannomutase/phosphoglucomutase s108a mutant from p. Aeruginosa (see paper)
29% identity, 93% coverage: 11:432/452 of query aligns to 15:433/459 of 1k2yX
4il8A Crystal structure of an h329a mutant of p. Aeruginosa pmm/pgm (see paper)
29% identity, 93% coverage: 11:432/452 of query aligns to 15:433/459 of 4il8A
- active site: R16 (= R12), S104 (= S108), H105 (= H109), K114 (= K118), D238 (= D247), D240 (= D249), D242 (= D251), R243 (= R252), A325 (≠ H335), D336 (≠ G345)
- binding magnesium ion: S104 (= S108), D238 (= D247), D240 (= D249), D242 (= D251)
3rsmA Crystal structure of s108c mutant of pmm/pgm (see paper)
28% identity, 85% coverage: 49:432/452 of query aligns to 28:410/436 of 3rsmA
- active site: C87 (≠ S108), K91 (= K118), D215 (= D247), D217 (= D249), D219 (= D251), R220 (= R252), H302 (= H335), D313 (≠ G345)
- binding phosphate ion: C87 (≠ S108), D215 (= D247), D217 (= D249), D219 (= D251), R220 (= R252)
- binding zinc ion: D215 (= D247), D217 (= D249), D219 (= D251)
6nqhA Xanthomonas citri dephospho-pgm in complex with xylose-1-phosphate
31% identity, 86% coverage: 51:438/452 of query aligns to 40:436/448 of 6nqhA
- active site: S97 (= S108), H98 (= H109), K107 (= K118), D237 (= D247), D239 (= D249), D241 (= D251), R242 (= R252), H324 (= H335)
- binding magnesium ion: D237 (= D247), D239 (= D249), D241 (= D251)
- binding 1-O-phosphono-alpha-D-xylopyranose: S97 (= S108), H98 (= H109), K107 (= K118), D239 (= D249), R242 (= R252), R280 (≠ L290), S301 (≠ V312), G302 (= G313), E320 (= E331), S322 (= S333), H324 (= H335), R414 (= R416), S416 (= S418), N417 (≠ G419), T418 (= T420), R423 (= R425)
Sites not aligning to the query:
6np8A Xanthomonas citri phospho-pgm in complex with mannose-6-phosphate (see paper)
31% identity, 86% coverage: 51:438/452 of query aligns to 40:436/448 of 6np8A
- active site: S97 (= S108), H98 (= H109), K107 (= K118), D237 (= D247), D239 (= D249), D241 (= D251), R242 (= R252), H324 (= H335)
- binding calcium ion: S97 (= S108), D237 (= D247), D239 (= D249), D241 (= D251)
- binding 6-O-phosphono-alpha-D-mannopyranose: R280 (≠ L290), G302 (= G313), H303 (≠ D314), E320 (= E331), S322 (= S333), H324 (= H335), R414 (= R416), S416 (= S418), N417 (≠ G419), T418 (= T420), R423 (= R425)
Sites not aligning to the query:
6nolA Xanthomonas citri dephospho-pgm in complex with mannose-1-phosphate (see paper)
31% identity, 86% coverage: 51:438/452 of query aligns to 40:436/448 of 6nolA
- active site: S97 (= S108), H98 (= H109), K107 (= K118), D237 (= D247), D239 (= D249), D241 (= D251), R242 (= R252), H324 (= H335)
- binding 1-O-phosphono-alpha-D-mannopyranose: G302 (= G313), E320 (= E331), S322 (= S333), H324 (= H335), R414 (= R416), S416 (= S418), N417 (≠ G419), T418 (= T420), R423 (= R425)
- binding magnesium ion: S97 (= S108), D237 (= D247), D239 (= D249), D241 (= D251)
Sites not aligning to the query:
Query Sequence
>BPHYT_RS14155 FitnessBrowser__BFirm:BPHYT_RS14155
MARRYFGTDGIRGKVGEGPITPEFVLRLGYAAGKVLAGADRWAKSGTRPTVLIGKDTRVS
GYMLEAALESGFSAAGVDVMLAGPMPTPGIAYLTRALRLAAGVVISASHNPYYDNGIKFF
SADGNKLPDEVESQIEEQLDLPLACAASEQLGKARRLDDAAGRYIEFCKSTFPAAFDLHG
LKLVVDCAHGAAYDVAPHVFHELGAEVIPIGVAPNGFNINDGVGATAPDALVRAVRANHA
DLGIALDGDADRLQVVDAAGRLYNGDELLYILVKDRVATDGKVDGAVGTLMTNMAVEVAL
QEAGVKFVRAAVGDRYVLEQLREHGWQLGAEGSGHILSLDRHSTGDGIVSALLVLAAMKR
SEKTLADLLDGVTLFPQKLINVRMKPDADWKSSDAIRRAIAKAESALNGRGRVLIRASGT
EPVLRVMVEAENAADALQYAESIAGAVKEATA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory