Comparing BPHYT_RS14210 FitnessBrowser__BFirm:BPHYT_RS14210 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8ewoA Crystal structure of putative glyoxylase ii from pseudomonas aeruginosa
52% identity, 97% coverage: 9:262/263 of query aligns to 8:259/259 of 8ewoA
Q9SID3 Hydroxyacylglutathione hydrolase 2, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
42% identity, 100% coverage: 1:262/263 of query aligns to 68:324/324 of Q9SID3
2q42A Ensemble refinement of the protein crystal structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 (see paper)
43% identity, 97% coverage: 9:262/263 of query aligns to 6:254/254 of 2q42A
6rz0A Crystal structure of escherichia coli glyoxalase ii
45% identity, 97% coverage: 9:262/263 of query aligns to 6:251/251 of 6rz0A
Q8ZRM2 Hydroxyacylglutathione hydrolase; Glyoxalase II; Glx II; EC 3.1.2.6 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
43% identity, 97% coverage: 9:262/263 of query aligns to 6:251/251 of Q8ZRM2
2qedA Crystal structure of salmonella thyphimurium lt2 glyoxalase ii (see paper)
43% identity, 97% coverage: 9:262/263 of query aligns to 7:252/252 of 2qedA
O24496 Hydroxyacylglutathione hydrolase cytoplasmic; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
41% identity, 87% coverage: 9:237/263 of query aligns to 6:237/258 of O24496
Sites not aligning to the query:
1qh5B Human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl) glutathione (see paper)
39% identity, 97% coverage: 9:263/263 of query aligns to 6:256/260 of 1qh5B
1qh5A Human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl) glutathione (see paper)
39% identity, 97% coverage: 9:263/263 of query aligns to 6:256/260 of 1qh5A
1qh3A Human glyoxalase ii with cacodylate and acetate ions present in the active site (see paper)
39% identity, 97% coverage: 9:263/263 of query aligns to 6:256/260 of 1qh3A
Q16775 Hydroxyacylglutathione hydrolase, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Homo sapiens (Human) (see paper)
39% identity, 97% coverage: 9:263/263 of query aligns to 54:304/308 of Q16775
2p18A Crystal structure of the leishmania infantum glyoxalase ii (see paper)
31% identity, 90% coverage: 2:239/263 of query aligns to 11:270/283 of 2p18A
2zziA Crystal structure of ttha1623 in a di-iron-bound form (see paper)
35% identity, 60% coverage: 18:174/263 of query aligns to 14:182/198 of 2zziA
2zwrB Crystal structure of ttha1623 from thermus thermophilus hb8 (see paper)
35% identity, 60% coverage: 18:174/263 of query aligns to 16:184/207 of 2zwrB
2xf4A Crystal structure of salmonella enterica serovar typhimurium ycbl (see paper)
33% identity, 61% coverage: 7:166/263 of query aligns to 6:191/210 of 2xf4A
Sites not aligning to the query:
7l0bA Crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme (see paper)
29% identity, 61% coverage: 14:174/263 of query aligns to 13:185/202 of 7l0bA
7ev5A Crystal structure of bleg-1 b3 metallo-beta-lactamase (see paper)
29% identity, 65% coverage: 4:174/263 of query aligns to 2:191/209 of 7ev5A
Q9C8L4 Persulfide dioxygenase ETHE1 homolog, mitochondrial; Glyoxalase II; Glx II; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 62% coverage: 15:176/263 of query aligns to 64:234/294 of Q9C8L4
3tp9A Crystal structure of alicyclobacillus acidocaldarius protein with beta-lactamase and rhodanese domains
33% identity, 61% coverage: 15:174/263 of query aligns to 17:198/473 of 3tp9A
2gcuA X-ray structure of gene product from arabidopsis thaliana at1g53580 (see paper)
30% identity, 62% coverage: 15:176/263 of query aligns to 15:185/244 of 2gcuA
>BPHYT_RS14210 FitnessBrowser__BFirm:BPHYT_RS14210
MNALEYVPVPAFDDNYIWVVSDGRHAAVVDPGEAAPVKAYLAKRGWRLSAILLTHHHQDH
VGGVADLLNGQAVPVYGPAGEAIEHLTHRLKNGDHVSIAAPALKLSVLDVPGHTSGHIAY
FQAADPQGTPHVFCGDTLFACGCGRLFEGTPKQMLASLDSLAALPGATEVHCAHEYTLSN
IRFALACEPGNAELQAWRDKASELRARDVPTLPTTIAHERAVNPFLRAGDPAVQASLREQ
LHEAVPDRLTAFTLMREWKNRFR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory