Comparing BPHYT_RS14900 FitnessBrowser__BFirm:BPHYT_RS14900 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
4wjiA Crystal structure of cyclohexadienyl dehydrogenase from sinorhizobium meliloti in complex with NADP and tyrosine
40% identity, 93% coverage: 6:295/313 of query aligns to 1:283/293 of 4wjiA
3gggD The crystal structure of a. Aeolicus prephenate dehydrogenase in complex with tyrosine and NAD+ (see paper)
35% identity, 94% coverage: 4:297/313 of query aligns to 8:292/293 of 3gggD
3ggoA Crystal structure of prephenate dehydrogenase from a. Aeolicus with hpp and nadh (see paper)
36% identity, 93% coverage: 6:297/313 of query aligns to 2:284/285 of 3ggoA
3ggpA Crystal structure of prephenate dehydrogenase from a. Aeolicus in complex with hydroxyphenyl propionate and NAD+ (see paper)
36% identity, 93% coverage: 6:297/313 of query aligns to 2:284/286 of 3ggpA
5uyyA Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with l-tyrosine (see paper)
35% identity, 91% coverage: 10:295/313 of query aligns to 10:287/373 of 5uyyA
Sites not aligning to the query:
6u60B Crystal structure of prephenate dehydrogenase tyra from bacillus anthracis in complex with NAD and l-tyrosine (see paper)
35% identity, 91% coverage: 10:295/313 of query aligns to 2:279/365 of 6u60B
Sites not aligning to the query:
3b1fA Crystal structure of prephenate dehydrogenase from streptococcus mutans (see paper)
33% identity, 94% coverage: 5:299/313 of query aligns to 2:286/286 of 3b1fA
2f1kA Crystal structure of synechocystis arogenate dehydrogenase (see paper)
30% identity, 93% coverage: 11:300/313 of query aligns to 2:279/279 of 2f1kA
2pv7B Crystal structure of chorismate mutase / prephenate dehydrogenase (tyra) (1574749) from haemophilus influenzae rd at 2.00 a resolution (see paper)
24% identity, 65% coverage: 10:211/313 of query aligns to 10:174/280 of 2pv7B
Sites not aligning to the query:
>BPHYT_RS14900 FitnessBrowser__BFirm:BPHYT_RS14900
MTDVAAFSFNKLVIFGVGLIGGSLARALRERGEADGARKVIGVGRSSASTERALELGVID
GSASLNDDAALSEALKGADFVLLAAPVAQTQPLLERIAPFLDAATIVTDAGSTKSDVVAA
ARAALGARIGQFVPGHPIAGREASGVEAALPDLYVGRNVVLCPLPENAPADVERVAAMWR
ATGALVRDMAPEQHDRVLASVSHLPHVLSFALVEQILNSPDAALKFSFAAGGFRDFTRIA
ASSPEMWRDVCVANRVALLDELDAYTAVLARLRAAIEAADGAALEAVFARSRVARTEWQE
QRAAGVANSDASK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory