SitesBLAST
Comparing BPHYT_RS14995 FitnessBrowser__BFirm:BPHYT_RS14995 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6tg9A Cryo-em structure of nadh reduced form of NAD+-dependent formate dehydrogenase from rhodobacter capsulatus (see paper)
68% identity, 94% coverage: 37:959/982 of query aligns to 8:938/949 of 6tg9A
- active site: K289 (= K310), C380 (= C401), H381 (= H402), L545 (= L566), G582 (= G603), Q583 (= Q604)
- binding fe2/s2 (inorganic) cluster: C51 (= C81), V59 (≠ F89), G60 (= G90), C62 (= C92), C65 (= C95), C79 (= C109)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: C255 (= C276), K289 (= K310), R351 (= R372), C352 (= C373), C380 (= C401), G414 (= G435), A415 (= A436), D419 (= D440), G420 (= G441), H421 (= H442), P443 (= P464), R444 (= R465), P464 (= P485), N467 (= N488), L545 (= L566), G546 (= G567), H550 (= H571), G582 (= G603), Q583 (= Q604), Q583 (= Q604), G649 (= G670), E650 (= E671), S655 (= S676), N680 (= N701), S693 (= S714), K698 (= K719), D724 (= D745), T820 (= T841), T821 (= T842), R823 (= R844), R823 (= R844), I824 (= I845), L825 (= L846), N829 (= N850), V830 (= V851), Q833 (= Q854), N902 (= N923), Y918 (= Y939), K919 (= K940)
- binding iron/sulfur cluster: H111 (= H141), C115 (= C145), C118 (= C148), A120 (= A150), C124 (= C154), C176 (= C196), I177 (= I197), V178 (= V198), C179 (= C199), M180 (≠ N200), C182 (= C202), C186 (= C206), I206 (≠ V226), C218 (= C239), S220 (= S241), C221 (= C242), G222 (= G243), C224 (= C245), C228 (= C249), T230 (= T251), A231 (= A252), C252 (= C273), Y254 (= Y275), C255 (= C276), V257 (= V278), C259 (= C280), F261 (= F282), C287 (= C308), K289 (= K310), V423 (= V444)
7vw6A Cryo-em structure of formate dehydrogenase 1 from methylorubrum extorquens am1 (see paper)
37% identity, 92% coverage: 49:948/982 of query aligns to 2:912/913 of 7vw6A
- binding fe2/s2 (inorganic) cluster: H32 (≠ K79), C34 (= C81), H35 (vs. gap), G45 (= G90), C47 (= C92), R48 (= R93), C50 (= C95), C64 (= C109)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K263 (= K310), K339 (≠ R372), C364 (= C397), C368 (= C401), G402 (= G435), N404 (= N437), N408 (≠ G441), D431 (= D463), P432 (= P464), R433 (= R465), F447 (≠ L483), G450 (= G486), D452 (≠ N488), G525 (= G565), M526 (≠ L566), G527 (= G567), Q530 (≠ E570), H531 (= H571), G563 (= G603), Q564 (= Q604), G630 (= G670), N632 (≠ D672), S636 (= S676), Q656 (= Q696), D657 (= D697), L658 (≠ I698), T805 (= T842), R807 (= R844), R807 (= R844), V808 (≠ I845), L809 (= L846), H811 (≠ Q848), W812 (≠ Y849), H813 (≠ N850), H813 (≠ N850), T814 (≠ V851), M817 (≠ Q854), F879 (= F915), N887 (= N923), F903 (≠ Y939), K904 (= K940)
- binding iron/sulfur cluster: C145 (= C196), I146 (= I197), Q147 (≠ V198), C148 (= C199), N149 (= N200), C151 (= C202), C155 (= C206), N161 (≠ T212), V163 (≠ A214), I164 (≠ L215), V175 (= V226), C188 (= C239), V189 (= V240), A190 (≠ S241), C191 (= C242), G192 (= G243), C194 (= C245), C198 (= C249), P199 (= P250), T200 (= T251), A202 (≠ T253), L203 (= L254), C227 (= C273), C230 (= C276), C234 (= C280), C261 (= C308), K263 (= K310), G264 (= G311), V411 (= V444)
1fdiA Oxidized form of formate dehydrogenase h from e. Coli complexed with the inhibitor nitrite (see paper)
38% identity, 72% coverage: 269:973/982 of query aligns to 4:708/715 of 1fdiA
- active site: C11 (= C276), L41 (≠ A307), C42 (= C308), K44 (= K310), S108 (= S370), R110 (= R372), D134 (= D395), C140 (= C401), H141 (= H402), S180 (≠ G441), M297 (≠ L566), R333 (= R602), G334 (= G603), Q335 (= Q604)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K44 (= K310), R110 (= R372), G111 (≠ C373), V139 (= V400), C140 (= C401), F173 (≠ I434), G174 (= G435), Y175 (≠ A436), N176 (= N437), D179 (= D440), S180 (≠ G441), C201 (≠ V462), D202 (= D463), P203 (= P464), R204 (= R465), L218 (= L483), G221 (= G486), N223 (= N488), G296 (= G565), M297 (≠ L566), G298 (= G567), F302 (≠ H571), G334 (= G603), Q335 (= Q604), Q335 (= Q604), G402 (= G670), E403 (= E671), T408 (≠ S676), Q428 (= Q696), D429 (= D697), I430 (= I698), S445 (≠ G713), D478 (= D745), T579 (= T842), V580 (≠ G843), R581 (= R844), R581 (= R844), E582 (≠ I845), H585 (≠ Q848), Y586 (= Y849), S587 (≠ N850), C588 (≠ V851), Y654 (≠ F915), N662 (= N923), Y678 (= Y939), K679 (= K940)
- binding nitrite ion: C140 (= C401), H141 (= H402), R333 (= R602), G334 (= G603), V338 (= V607)
- binding iron/sulfur cluster: C8 (= C273), Y10 (= Y275), C11 (= C276), S13 (≠ V278), C15 (= C280), L41 (≠ A307), C42 (= C308), K44 (= K310), P182 (= P443), I183 (≠ V444)
P07658 Formate dehydrogenase H; Formate dehydrogenase-H subunit alpha; FDH-H; Formate-hydrogen-lyase-linked, selenocysteine-containing polypeptide; EC 1.17.98.4 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 72% coverage: 269:973/982 of query aligns to 4:708/715 of P07658
- C8 (= C273) binding
- Y10 (= Y275) binding
- C11 (= C276) binding
- C15 (= C280) binding
- C42 (= C308) binding
- K44 (= K310) binding
- U140 (≠ C401) modified: nonstandard, Selenocysteine
- M297 (≠ L566) binding
- Q301 (≠ E570) binding
- Q335 (= Q604) binding
- S445 (≠ G713) binding
- D478 (= D745) binding
- C588 (≠ V851) binding
- Y654 (≠ F915) binding
- Q655 (≠ H916) binding
- Y678 (= Y939) binding
- K679 (= K940) binding
2iv2X Reinterpretation of reduced form of formate dehydrogenase h from e. Coli (see paper)
37% identity, 72% coverage: 269:973/982 of query aligns to 4:690/697 of 2iv2X
- active site: C11 (= C276), L41 (≠ A307), C42 (= C308), K44 (= K310), S108 (= S370), C140 (= C401), H141 (= H402), S180 (≠ G441), M297 (≠ L566), R333 (= R602), G334 (= G603), Q335 (= Q604)
- binding guanylate-o'-phosphoric acidmono-(2-amino-5,6-dimercapto-4-oxo-3,5,6,7,8a,9,10,10a-octahydro-4h-8-oxa-1,3,9,10-tetraaza-anthracen-7-ylmethyl) ester: R110 (= R372), G111 (≠ C373), T112 (= T374), A137 (= A398), Q335 (= Q604), G402 (= G670), E403 (= E671), D404 (= D672), T408 (≠ S676), A410 (≠ P678), Q428 (= Q696), D429 (= D697), I430 (= I698), S445 (≠ G713), D478 (= D745), C588 (≠ V851), Y660 (= Y939)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K44 (= K310), F173 (≠ I434), G174 (= G435), Y175 (≠ A436), N176 (= N437), D179 (= D440), S180 (≠ G441), D202 (= D463), P203 (= P464), R204 (= R465), N223 (= N488), G296 (= G565), M297 (≠ L566), F302 (≠ H571), G334 (= G603), R581 (= R844), E582 (≠ I845), V583 (≠ L846), H585 (≠ Q848), Y586 (= Y849), S587 (≠ N850), K661 (= K940)
- binding iron/sulfur cluster: C8 (= C273), C11 (= C276), S13 (≠ V278), C15 (= C280), L41 (≠ A307), C42 (= C308), K44 (= K310), G45 (= G311), I183 (≠ V444)
7qv7S Cryo-em structure of hydrogen-dependent co2 reductase. (see paper)
40% identity, 55% coverage: 266:806/982 of query aligns to 1:534/571 of 7qv7S
7bkbD Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) (see paper)
38% identity, 56% coverage: 269:819/982 of query aligns to 7:538/549 of 7bkbD
2v45A A new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand (see paper)
29% identity, 70% coverage: 264:946/982 of query aligns to 4:720/723 of 2v45A
- active site: K49 (= K310), S109 (= S370), C140 (= C401), M141 (≠ H402), A180 (≠ G441), M308 (≠ L566), T344 (≠ R602), G345 (= G603), Q346 (= Q604)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R14 (≠ A274), K49 (= K310), Q111 (≠ R372), C140 (= C401), G174 (= G435), N176 (= N437), E179 (≠ D440), A180 (≠ G441), D204 (= D463), P205 (= P464), R206 (= R465), P222 (= P485), D225 (≠ N488), C307 (≠ G565), M308 (≠ L566), G309 (= G567), Q312 (≠ E570), R313 (≠ H571), G345 (= G603), Q346 (= Q604), Q346 (= Q604), E416 (≠ G670), T417 (≠ E671), N418 (≠ D672), T422 (≠ S676), I443 (≠ Q696), E444 (≠ D697), A445 (≠ I698), F446 (= F699), P461 (≠ G713), F463 (≠ S715), S615 (≠ T842), M616 (≠ G843), R617 (= R844), R617 (= R844), V618 (≠ I845), I619 (≠ L846), H621 (≠ Q848), W622 (≠ Y849), H623 (≠ N850), H623 (≠ N850), T624 (≠ V851), T626 (≠ A853), F689 (= F915), N697 (= N923), Y713 (= Y939), K714 (= K940)
- binding iron/sulfur cluster: C13 (= C273), C16 (= C276), T18 (≠ V278), C20 (= C280), L46 (≠ A307), C47 (= C308), V183 (= V444)
2jirA A new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand (see paper)
29% identity, 70% coverage: 264:946/982 of query aligns to 1:717/720 of 2jirA
- active site: K46 (= K310), S106 (= S370), C137 (= C401), M138 (≠ H402), A177 (≠ G441), M305 (≠ L566), T341 (≠ R602), G342 (= G603), Q343 (= Q604)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R11 (≠ A274), K46 (= K310), Q108 (≠ R372), C137 (= C401), G171 (= G435), S172 (≠ A436), N173 (= N437), E176 (≠ D440), A177 (≠ G441), D201 (= D463), P202 (= P464), R203 (= R465), F217 (≠ L483), D222 (≠ N488), C304 (≠ G565), M305 (≠ L566), G306 (= G567), Q309 (≠ E570), R310 (≠ H571), G342 (= G603), Q343 (= Q604), Q343 (= Q604), E413 (≠ G670), T414 (≠ E671), N415 (≠ D672), T419 (≠ S676), I440 (≠ Q696), E441 (≠ D697), A442 (≠ I698), P458 (≠ G713), F460 (≠ S715), S612 (≠ T842), M613 (≠ G843), R614 (= R844), R614 (= R844), I616 (≠ L846), H618 (≠ Q848), W619 (≠ Y849), H620 (≠ N850), H620 (≠ N850), T621 (≠ V851), T623 (≠ A853), F686 (= F915), N694 (= N923), Y710 (= Y939), K711 (= K940)
- binding nitrite ion: V615 (≠ I845), F686 (= F915)
- binding iron/sulfur cluster: C10 (= C273), C13 (= C276), T15 (≠ V278), C17 (= C280), L43 (≠ A307), C44 (= C308), P179 (= P443), V180 (= V444)
2jiqA A new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand (see paper)
29% identity, 70% coverage: 264:946/982 of query aligns to 1:717/720 of 2jiqA
- active site: K46 (= K310), S106 (= S370), C137 (= C401), M138 (≠ H402), A177 (≠ G441), M305 (≠ L566), T341 (≠ R602), G342 (= G603), Q343 (= Q604)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R11 (≠ A274), Q108 (≠ R372), C137 (= C401), G171 (= G435), S172 (≠ A436), E176 (≠ D440), A177 (≠ G441), D201 (= D463), P202 (= P464), R203 (= R465), P219 (= P485), D222 (≠ N488), C304 (≠ G565), M305 (≠ L566), G306 (= G567), Q309 (≠ E570), R310 (≠ H571), G342 (= G603), Q343 (= Q604), Q343 (= Q604), E413 (≠ G670), T414 (≠ E671), N415 (≠ D672), T419 (≠ S676), I440 (≠ Q696), E441 (≠ D697), F443 (= F699), P458 (≠ G713), F460 (≠ S715), S612 (≠ T842), M613 (≠ G843), R614 (= R844), R614 (= R844), I616 (≠ L846), H618 (≠ Q848), W619 (≠ Y849), H620 (≠ N850), H620 (≠ N850), T621 (≠ V851), T623 (≠ A853), F686 (= F915), N694 (= N923), Y710 (= Y939), K711 (= K940)
- binding nitrate ion: M251 (≠ V510), K583 (≠ R815), V589 (= V821), W591 (≠ T823), R593 (≠ F825), V704 (≠ A933)
- binding iron/sulfur cluster: C10 (= C273), C13 (= C276), T15 (≠ V278), C17 (= C280), L43 (≠ A307), C44 (= C308), V180 (= V444)
P81186 Periplasmic nitrate reductase; EC 1.9.6.1 from Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB) (see 3 papers)
29% identity, 70% coverage: 264:946/982 of query aligns to 36:752/755 of P81186
Sites not aligning to the query:
- 1:32 signal peptide, Tat-type signal
7t30A Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/NAD(h) bound state (see paper)
27% identity, 70% coverage: 48:739/982 of query aligns to 3:618/666 of 7t30A
- binding fe2/s2 (inorganic) cluster: C36 (= C81), G45 (= G90), C47 (= C92), R48 (= R93), C50 (= C95), C64 (= C109)
- binding iron/sulfur cluster: F93 (≠ I138), H98 (≠ L143), F99 (≠ D144), C100 (= C145), C103 (= C148), Q105 (≠ A150), C109 (= C154), L141 (≠ F189), R147 (≠ K195), C148 (= C196), L150 (≠ V198), C151 (= C199), Q152 (≠ N200), C154 (= C202), C158 (= C206), C192 (= C239), V193 (= V240), N194 (≠ S241), C195 (= C242), G196 (= G243), A197 (= A244), C198 (= C245), C202 (= C249), P203 (= P250), T204 (= T251), G205 (≠ A252), T206 (= T253), I207 (≠ L254), C229 (= C273), C232 (= C276), G235 (= G279), C236 (= C280), L263 (≠ A307), C264 (= C308), V396 (= V444)
8oh5C Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
27% identity, 66% coverage: 184:835/982 of query aligns to 601:1156/1172 of 8oh5C
- binding iron/sulfur cluster: C613 (= C196), V614 (≠ I197), L615 (≠ V198), C616 (= C199), G617 (≠ N200), C619 (= C202), C623 (= C206), I643 (≠ V226), C656 (= C239), I657 (≠ V240), S658 (= S241), C659 (= C242), G660 (= G243), C662 (= C245), C666 (= C249), G669 (≠ A252), A670 (≠ T253), C692 (= C273), Y694 (= Y275), C695 (= C276), C699 (= C280), C725 (= C308), R727 (≠ K310), G728 (= G311), V853 (= V444)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 199, 201, 202, 203, 222, 223, 229, 230, 235, 239, 264, 265, 285, 288, 332, 471, 477, 479
- binding fe2/s2 (inorganic) cluster: 36, 45, 47, 48, 50, 64
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 330, 331, 332, 333, 353, 354, 355, 432, 433, 434, 477
- binding iron/sulfur cluster: 96, 98, 100, 102, 104, 108, 147, 149, 151, 155, 156, 164, 170, 480, 562, 563, 565, 567, 573
8e9hG Mycobacterial respiratory complex i, fully-inserted quinone (see paper)
32% identity, 42% coverage: 49:464/982 of query aligns to 5:413/782 of 8e9hG
- binding fe2/s2 (inorganic) cluster: R35 (≠ K79), C37 (= C81), D38 (≠ A82), G46 (= G90), C48 (= C92), R49 (= R93), C51 (= C95), A63 (= A107), C65 (= C109)
- binding guanosine-5'-triphosphate: R320 (= R372)
- binding iron/sulfur cluster: H99 (= H141), D102 (= D144), C103 (= C145), C106 (= C148), G109 (≠ N151), C112 (= C154), Q115 (= Q157), C152 (= C196), V153 (≠ I197), L154 (≠ V198), C155 (= C199), A156 (≠ N200), R157 (= R201), C158 (= C202), C202 (= C249), P203 (= P250), V204 (≠ T251), A206 (≠ T253), L207 (= L254), C228 (= C273), C231 (= C276), S233 (≠ V278), C235 (= C280), N262 (≠ A307), C263 (= C308), G266 (= G311), P391 (= P443), I392 (≠ V444)
Sites not aligning to the query:
- binding guanosine-5'-triphosphate: 486, 487, 554, 556, 559, 579, 580, 582, 627, 689, 695, 696, 697
Q53176 Periplasmic nitrate reductase; EC 1.9.6.1 from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
24% identity, 69% coverage: 273:949/982 of query aligns to 48:831/831 of Q53176
- C48 (= C273) binding
- C51 (= C276) binding
- C55 (= C280) binding
- C83 (= C308) binding
- K85 (= K310) binding
- Q152 (≠ R372) binding
- N177 (≠ C397) binding
- C181 (= C401) binding
- 214:221 (vs. 434:441, 25% identical) binding
- GTD 264:266 (≠ GTN 486:488) binding
- M375 (≠ L566) binding
- Q379 (≠ E570) binding
- N485 (≠ D672) binding
- SD 511:512 (≠ QD 696:697) binding
- K534 (= K719) binding
- D561 (≠ E747) binding
- 721:730 (vs. 842:851, 40% identical) binding
- N805 (= N923) binding
- K822 (= K940) binding
7arcG Cryo-em structure of polytomella complex-i (peripheral arm) (see paper)
30% identity, 45% coverage: 53:496/982 of query aligns to 10:426/682 of 7arcG
- binding fe2/s2 (inorganic) cluster: R36 (≠ K79), C38 (= C81), Y39 (≠ A82), G47 (= G90), C49 (= C92), R50 (= R93), C52 (= C95), C66 (= C109)
- binding iron/sulfur cluster: H98 (= H141), D101 (= D144), C102 (= C145), C105 (= C148), Q107 (≠ A150), C111 (= C154), Q114 (= Q157), C150 (= C196), I151 (= I197), C153 (= C199), C156 (= C202), C200 (= C249), V202 (≠ T251), A204 (≠ T253), L205 (= L254)
- binding : K272 (≠ H320), Q274 (≠ D322), R275 (= R323), N277 (≠ T325)
Sites not aligning to the query:
7b0nG 3.7-angstrom structure of Yarrowia lipolytica complex I with an R121M mutation in NUCM. (see paper)
29% identity, 44% coverage: 48:479/982 of query aligns to 2:425/694 of 7b0nG
- binding fe2/s2 (inorganic) cluster: C35 (= C81), G44 (= G90), C46 (= C92), R47 (= R93), C49 (= C95), C63 (= C109)
- binding iron/sulfur cluster: H95 (= H141), C99 (= C145), C102 (= C148), C108 (= C154), Q111 (= Q157), C149 (= C196), H151 (≠ V198), C152 (= C199), T153 (≠ N200), C155 (= C202), C199 (= C249), V201 (≠ T251)
8a6tA Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
42% identity, 22% coverage: 49:260/982 of query aligns to 4:210/571 of 8a6tA
- binding fe2/s2 (inorganic) cluster: C36 (= C81), D37 (≠ A82), C47 (= C92), R48 (= R93), C50 (= C95), C63 (= C109)
- binding iron/sulfur cluster: H95 (= H141), C99 (= C145), C102 (= C148), C108 (= C154), C146 (= C196), C149 (= C199), G150 (≠ N200), K151 (≠ R201), C152 (= C202), C156 (= C206), C189 (= C239), C192 (= C242), C195 (= C245), C199 (= C249), G202 (≠ A252)
Sites not aligning to the query:
- binding 2 iron/2 sulfur/5 carbonyl/2 water inorganic cluster: 229, 230, 231, 298, 323, 352, 353, 357, 412, 500
- binding iron/sulfur cluster: 299, 354, 496, 500
7v2cM Active state complex i from q10 dataset (see paper)
30% identity, 41% coverage: 49:451/982 of query aligns to 4:392/690 of 7v2cM
- binding fe2/s2 (inorganic) cluster: C36 (= C81), Y37 (≠ A82), G45 (= G90), C47 (= C92), R48 (= R93), C50 (= C95), C64 (= C109)
- binding magnesium ion: Q105 (≠ A150), C198 (= C249), V200 (≠ T251)
- binding iron/sulfur cluster: H96 (= H141), D99 (= D144), C100 (= C145), C103 (= C148), Q105 (≠ A150), C109 (= C154), Q112 (= Q157), C148 (= C196), C151 (= C199), T152 (≠ N200), R153 (= R201), C154 (= C202), C198 (= C249), V200 (≠ T251), A202 (≠ T253), L203 (= L254)
5gupG structure of mammalian respiratory supercomplex I1III2IV1 (see paper)
30% identity, 41% coverage: 49:451/982 of query aligns to 3:391/673 of 5gupG
- binding fe2/s2 (inorganic) cluster: C35 (= C81), Y36 (≠ A82), N45 (≠ S91), C46 (= C92), C49 (= C95), C63 (= C109)
- binding iron/sulfur cluster: H95 (= H141), C99 (= C145), C102 (= C148), Q104 (≠ A150), C108 (= C154), Q111 (= Q157), R146 (≠ K195), C147 (= C196), I148 (= I197), C150 (= C199), T151 (≠ N200), C153 (= C202), V177 (= V226), C197 (= C249), P198 (= P250), A201 (≠ T253), L202 (= L254)
- binding : K269 (≠ H320), R270 (≠ K321), Q271 (≠ D322), R272 (= R323), R279 (= R330), L284 (≠ P336), L285 (≠ W337), Y287 (≠ E339)
Query Sequence
>BPHYT_RS14995 FitnessBrowser__BFirm:BPHYT_RS14995
MSDVLNSPTGGCGSGNCACKSQAQQQRAPRSFFDDTDFGTPERHADIDITLEIDGQSVTV
PAGTSVMRAAVEAGVNVPKLCATDSLEPFGSCRLCLVEIEGKRGYPASCTTPVEAGMKVR
TQTDRLQSLRRNVMELYISDHPLDCLTCPANGDCELQDMAGVTGLREVRYGFDGANHLKD
KKDESNPYFTYDASKCIVCNRCVRACEETQGTFALTIAGRGFESRVAASENVPFMESECV
SCGACVAACPTATLQEKTVIMLGQAEHSVVTTCAYCGVGCSFKAEMKGNEVVRMVPHKNG
QANEGHACVKGRFAWGYATHKDRITKPMIRAKITDPWREVSWEEALTYAASEFRRIQAKH
GRDSIGGITSSRCTNEETYLVQKLVRAAFGNNNVDTCARVCHSPTGYGLKTTLGESAGTQ
TFASVDKADVIMVIGANPTDGHPVFGSRLKRRVREGAKLIVVDPRRIDIVDTPHVKASHH
LQLRPGTNVAVVNALAHVIVTEGLVNEAFVAERCETRAFEQWRDFVALPENAPEATEAVT
GVPAQFVREAARIYATGGNAAIYYGLGVTEHAQGSTMVMGIANLAMATGNIGREGVGVNP
LRGQNNVQGSCDMGSFPHELPGYRHISDTVTRTLFEDAWNVTLQPEPGLRIPNMFDAAVH
GTFKGLYCQGEDIVQSDPNTHHVSAALSSMECIVVQDIFLNETAKYAHVLLPGSSFLEKD
GTFTNAERRISRVRKVMPPVPGYADWEVTVMLSRALGYEMDYTHPSQIMDEIARLTPTFH
GVSYKKLDEMGSIQWPCNEDAPDGTPTMHIDSFVRGKGKFVITKFIATPEKVTRKFPMLL
TTGRILSQYNVGAQTRRTENSRWHDEDRLEIHPHDAEERGIKTDDWVGIESRAGQTVLRA
KVTERMQPGVVYTTFHFPESGANVITTDSSDWATNCPEYKVTAVQVMPVEQPSQWQKEYS
RFNTEQLDLLKQRELANATSGK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory