SitesBLAST
Comparing BPHYT_RS15425 FitnessBrowser__BFirm:BPHYT_RS15425 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
65% identity, 99% coverage: 4:321/321 of query aligns to 5:322/323 of O59791
- S82 (= S81) mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
65% identity, 99% coverage: 4:321/321 of query aligns to 1:318/319 of 2zr8A
- active site: K53 (= K56), S78 (= S81), E204 (= E207), G208 (= G211), D210 (= D213), G232 (= G235), I303 (≠ V306), S304 (= S307)
- binding magnesium ion: E204 (= E207), G208 (= G211), D210 (= D213)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F55), K53 (= K56), S77 (= S80), S78 (= S81), N80 (= N83), H81 (= H84), P147 (= P150), G179 (= G182), G180 (= G183), G181 (= G184), G182 (= G185), G232 (= G235), E277 (= E280), T279 (= T282), S304 (= S307)
- binding serine: S78 (= S81), R129 (= R132), D231 (= D234), G232 (= G235), A233 (= A236), Q234 (≠ A237), T235 (≠ S238)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
65% identity, 99% coverage: 4:321/321 of query aligns to 1:318/319 of 2zpuA
- active site: K53 (= K56), S78 (= S81), E204 (= E207), G208 (= G211), D210 (= D213), G232 (= G235), I303 (≠ V306), S304 (= S307)
- binding magnesium ion: E204 (= E207), G208 (= G211), D210 (= D213)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F55), K53 (= K56), S77 (= S80), S78 (= S81), N80 (= N83), H81 (= H84), P147 (= P150), G179 (= G182), G180 (= G183), G181 (= G184), G182 (= G185), G232 (= G235), E277 (= E280), T279 (= T282), S304 (= S307)
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
65% identity, 98% coverage: 7:321/321 of query aligns to 3:317/318 of 1wtcA
- active site: K52 (= K56), S77 (= S81), E203 (= E207), G207 (= G211), D209 (= D213), G231 (= G235), I302 (≠ V306), S303 (= S307)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ H24), K47 (≠ R51), M48 (= M52), A109 (= A113), A110 (= A114), Y114 (= Y118)
- binding magnesium ion: E203 (= E207), G207 (= G211), D209 (= D213)
- binding pyridoxal-5'-phosphate: F51 (= F55), K52 (= K56), N79 (= N83), G178 (= G182), G179 (= G183), G180 (= G184), G181 (= G185), G231 (= G235), E276 (= E280), T278 (= T282), S303 (= S307)
1v71A Crystal structure of s.Pombe serine racemase
65% identity, 98% coverage: 7:321/321 of query aligns to 3:317/318 of 1v71A
- active site: K52 (= K56), S77 (= S81), E203 (= E207), G207 (= G211), D209 (= D213), G231 (= G235), I302 (≠ V306), S303 (= S307)
- binding magnesium ion: E203 (= E207), G207 (= G211), D209 (= D213)
- binding pyridoxal-5'-phosphate: F51 (= F55), K52 (= K56), N79 (= N83), G178 (= G182), G179 (= G183), G180 (= G184), G181 (= G185), G231 (= G235), E276 (= E280), T278 (= T282), S303 (= S307), G304 (= G308)
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
66% identity, 98% coverage: 8:320/321 of query aligns to 5:317/319 of A4F2N8
- K53 (= K56) mutation to A: Loss of enzymatic activity.
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
43% identity, 96% coverage: 12:320/321 of query aligns to 24:336/339 of Q7XSN8
- E219 (= E207) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (= D213) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
5cvcA Structure of maize serine racemase (see paper)
43% identity, 98% coverage: 6:320/321 of query aligns to 2:320/329 of 5cvcA
- active site: K52 (= K56), S77 (= S81), E203 (= E207), A207 (≠ G211), D209 (= D213), G231 (= G235), V306 (= V306), S307 (= S307)
- binding magnesium ion: E203 (= E207), A207 (≠ G211), D209 (= D213)
- binding pyridoxal-5'-phosphate: F51 (= F55), K52 (= K56), N79 (= N83), S178 (≠ G182), G179 (= G183), G180 (= G184), G181 (= G185), L232 (≠ A236), E275 (= E280), S307 (= S307), G308 (= G308)
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
42% identity, 95% coverage: 8:313/321 of query aligns to 5:316/322 of 7nbgAAA
- active site: K53 (= K56), S81 (= S81), E207 (= E207), A211 (≠ G211), D213 (= D213), G236 (= G235), L309 (≠ V306), S310 (= S307)
- binding calcium ion: E207 (= E207), A211 (≠ G211), D213 (= D213)
- binding pyridoxal-5'-phosphate: F52 (= F55), K53 (= K56), N83 (= N83), G182 (= G182), G183 (= G183), G184 (= G184), G185 (= G185), M186 (≠ L186), G236 (= G235), V237 (≠ A236), T282 (= T282), S310 (= S307), G311 (= G308)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (= S81), G85 (≠ A85), Q86 (= Q86), I101 (= I101), K111 (= K111), I115 (≠ T115), Y118 (= Y118)
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
42% identity, 95% coverage: 8:313/321 of query aligns to 5:316/320 of 7nbhAAA
- active site: K53 (= K56), S81 (= S81), E207 (= E207), A211 (≠ G211), D213 (= D213), G236 (= G235), L309 (≠ V306), S310 (= S307)
- binding calcium ion: E207 (= E207), A211 (≠ G211), D213 (= D213)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (= S81), G85 (≠ A85), Q86 (= Q86), K111 (= K111), I115 (≠ T115), Y118 (= Y118), D235 (= D234), P281 (= P281), N313 (= N310), V314 (= V311), D315 (= D312)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
42% identity, 95% coverage: 8:313/321 of query aligns to 5:316/323 of 7nbfAAA
- active site: K53 (= K56), S81 (= S81), E207 (= E207), A211 (≠ G211), D213 (= D213), G236 (= G235), L309 (≠ V306), S310 (= S307)
- binding calcium ion: E207 (= E207), A211 (≠ G211), D213 (= D213)
- binding magnesium ion: N244 (≠ Y244)
- binding pyridoxal-5'-phosphate: F52 (= F55), K53 (= K56), N83 (= N83), G182 (= G182), G183 (= G183), G184 (= G184), G185 (= G185), M186 (≠ L186), G236 (= G235), V237 (≠ A236), T282 (= T282), S310 (= S307), G311 (= G308)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: H21 (= H24), L22 (≠ R25), T23 (= T26), P24 (= P27), L26 (= L29), T27 (= T30), F46 (= F49)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
42% identity, 95% coverage: 8:313/321 of query aligns to 5:316/323 of 7nbdAAA
- active site: K53 (= K56), S81 (= S81), E207 (= E207), A211 (≠ G211), D213 (= D213), G236 (= G235), L309 (≠ V306), S310 (= S307)
- binding calcium ion: E207 (= E207), A211 (≠ G211), D213 (= D213)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ A272), L278 (≠ V278), V314 (= V311), L316 (= L313)
- binding magnesium ion: N244 (≠ Y244)
- binding pyridoxal-5'-phosphate: F52 (= F55), K53 (= K56), N83 (= N83), G182 (= G182), G183 (= G183), G184 (= G184), G185 (= G185), M186 (≠ L186), G236 (= G235), V237 (≠ A236), E280 (= E280), T282 (= T282), S310 (= S307), G311 (= G308)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
42% identity, 95% coverage: 8:313/321 of query aligns to 5:316/323 of 7nbcCCC
- active site: K53 (= K56), S81 (= S81), E207 (= E207), A211 (≠ G211), D213 (= D213), G236 (= G235), L309 (≠ V306), S310 (= S307)
- binding biphenyl-4-ylacetic acid: T78 (= T78), H79 (≠ Y79), H84 (= H84), V148 (≠ I148), H149 (≠ P149), P150 (= P150)
- binding calcium ion: E207 (= E207), A211 (≠ G211), D213 (= D213)
- binding pyridoxal-5'-phosphate: F52 (= F55), K53 (= K56), N83 (= N83), G182 (= G182), G183 (= G183), G184 (= G184), G185 (= G185), M186 (≠ L186), G236 (= G235), V237 (≠ A236), T282 (= T282), S310 (= S307), G311 (= G308)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
42% identity, 95% coverage: 8:313/321 of query aligns to 5:316/323 of 7nbcAAA
- active site: K53 (= K56), S81 (= S81), E207 (= E207), A211 (≠ G211), D213 (= D213), G236 (= G235), L309 (≠ V306), S310 (= S307)
- binding calcium ion: E207 (= E207), A211 (≠ G211), D213 (= D213)
- binding magnesium ion: N244 (≠ Y244)
- binding pyridoxal-5'-phosphate: F52 (= F55), K53 (= K56), N83 (= N83), G182 (= G182), G183 (= G183), G184 (= G184), G185 (= G185), M186 (≠ L186), G236 (= G235), V237 (≠ A236), T282 (= T282), S310 (= S307), G311 (= G308)
Sites not aligning to the query:
6zspAAA serine racemase bound to atp and malonate. (see paper)
41% identity, 95% coverage: 8:313/321 of query aligns to 5:309/320 of 6zspAAA
- active site: K53 (= K56), S74 (= S81), E200 (= E207), A204 (≠ G211), D206 (= D213), G229 (= G235), L302 (≠ V306), S303 (= S307)
- binding adenosine-5'-triphosphate: S28 (= S31), S29 (= S32), I30 (≠ T33), K48 (≠ R51), T49 (≠ M52), Q79 (= Q86), Y111 (= Y118), E266 (≠ Q273), R267 (= R274), K269 (= K276), N306 (= N310)
- binding magnesium ion: E200 (= E207), A204 (≠ G211), D206 (= D213)
- binding malonate ion: K53 (= K56), S73 (= S80), S74 (= S81), N76 (= N83), H77 (= H84), R125 (= R132), G229 (= G235), S232 (= S238)
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
41% identity, 95% coverage: 8:313/321 of query aligns to 6:312/322 of 3l6bA
- active site: K54 (= K56), S77 (= S81), E203 (= E207), A207 (≠ G211), D209 (= D213), G232 (= G235), T278 (= T282), L305 (≠ V306), S306 (= S307)
- binding malonate ion: K54 (= K56), S76 (= S80), S77 (= S81), N79 (= N83), H80 (= H84), R128 (= R132), G232 (= G235)
- binding manganese (ii) ion: E203 (= E207), A207 (≠ G211), D209 (= D213)
- binding pyridoxal-5'-phosphate: F53 (= F55), K54 (= K56), N79 (= N83), G178 (= G182), G179 (= G183), G180 (= G184), G181 (= G185), M182 (≠ L186), V233 (≠ A236), E276 (= E280), T278 (= T282), S306 (= S307), G307 (= G308)
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
40% identity, 95% coverage: 8:312/321 of query aligns to 5:310/310 of 7nbgDDD
- active site: K53 (= K56), S76 (= S81), E202 (= E207), A206 (≠ G211), D208 (= D213), G231 (= G235), L304 (≠ V306), S305 (= S307)
- binding calcium ion: E202 (= E207), A206 (≠ G211), D208 (= D213)
- binding magnesium ion: N239 (≠ Y244)
- binding ortho-xylene: S76 (= S81), Q81 (= Q86), I96 (= I101), Y113 (= Y118)
- binding pyridoxal-5'-phosphate: F52 (= F55), K53 (= K56), N78 (= N83), G177 (= G182), G178 (= G183), G179 (= G184), G180 (= G185), M181 (≠ L186), G231 (= G235), V232 (≠ A236), E275 (= E280), T277 (= T282), S305 (= S307), G306 (= G308)
Sites not aligning to the query:
Q9QZX7 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Mus musculus (Mouse) (see paper)
41% identity, 96% coverage: 8:316/321 of query aligns to 8:322/339 of Q9QZX7
- C113 (≠ A110) modified: S-nitrosocysteine; mutation to S: Abolishes S-nitrosylation.
3hmkA Crystal structure of serine racemase (see paper)
40% identity, 97% coverage: 8:317/321 of query aligns to 6:321/321 of 3hmkA
- active site: K54 (= K56), S82 (= S81), E208 (= E207), A212 (≠ G211), D214 (= D213), G237 (= G235), T283 (= T282), L310 (≠ V306), S311 (= S307)
- binding manganese (ii) ion: E208 (= E207), A212 (≠ G211), D214 (= D213)
- binding pyridoxal-5'-phosphate: F53 (= F55), K54 (= K56), N84 (= N83), G183 (= G182), G184 (= G183), G185 (= G184), G186 (= G185), M187 (≠ L186), G237 (= G235), V238 (≠ A236), T283 (= T282), S311 (= S307), G312 (= G308)
1ve5A Crystal structure of t.Th. Hb8 threonine deaminase
40% identity, 96% coverage: 7:313/321 of query aligns to 1:306/308 of 1ve5A
- active site: K50 (= K56), S56 (= S65), S72 (= S81), E200 (= E207), A204 (≠ G211), D206 (= D213), G229 (= G235), L299 (≠ V306), S300 (= S307)
- binding calcium ion: E200 (= E207), A204 (≠ G211), D206 (= D213)
- binding pyridoxal-5'-phosphate: F49 (= F55), K50 (= K56), N74 (= N83), G175 (vs. gap), G176 (vs. gap), G177 (vs. gap), G178 (vs. gap), E274 (= E280), T276 (= T282), S300 (= S307), G301 (= G308)
Query Sequence
>BPHYT_RS15425 FitnessBrowser__BFirm:BPHYT_RS15425
MQALPAPTFDDVLDAAARLNGVAHRTPVLTSSTFNERTGASVFFKCENFQRMGAFKFRGA
YNAISHFDAEQRKAGVLTYSSGNHAQAIALSARLAGIHATIVMPQDAPAAKVAATKGYGG
EVITYDRYTENREEIGRRLAEERGMTLIPPYDHPHVIAGQGTAVKELIEETGPLDMLFVC
LGGGGLISGSALAAAALSPACTVIGIEPEAGNDGQQSLARGEIVHIDTPRTIADGAASTH
LGDYTFAIIRKLVAQIETVSDAQLIETMRFFAQRMKIVVEPTGCLAAAAVLNGIVPVTGK
RVGVVVSGGNVDLEKLAQYLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory