SitesBLAST
Comparing BPHYT_RS16040 FitnessBrowser__BFirm:BPHYT_RS16040 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3d3wA Structure of l-xylulose reductase with bound coenzyme, phosphate and hydroxide. (see paper)
48% identity, 97% coverage: 7:244/245 of query aligns to 5:243/244 of 3d3wA
- active site: G18 (= G20), S136 (= S137), H146 (= H147), Y149 (= Y150), K153 (= K154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G16), G16 (≠ S18), K17 (≠ S19), G18 (= G20), I19 (= I21), S38 (≠ A40), R39 (= R41), T40 (≠ N42), V59 (≠ L60), L61 (≠ V62), N83 (≠ C84), A84 (= A85), A85 (≠ G86), V106 (= V107), V134 (= V135), S135 (= S136), S136 (= S137), Y149 (= Y150), K153 (= K154), P179 (= P180), T180 (= T181), V182 (≠ T183), T184 (= T185), S185 (≠ P186), M186 (= M187), G187 (≠ A188)
1pr9A Human l-xylulose reductase holoenzyme (see paper)
48% identity, 97% coverage: 7:244/245 of query aligns to 5:243/244 of 1pr9A
- active site: G18 (= G20), S136 (= S137), H146 (= H147), Y149 (= Y150), K153 (= K154)
- binding dihydrogenphosphate ion: S136 (= S137), C138 (≠ A139)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G16), G16 (≠ S18), K17 (≠ S19), G18 (= G20), I19 (= I21), S38 (≠ A40), R39 (= R41), T40 (≠ N42), L61 (≠ V62), N83 (≠ C84), A85 (≠ G86), V106 (= V107), V134 (= V135), Y149 (= Y150), K153 (= K154), T180 (= T181), V182 (≠ T183), T184 (= T185), M186 (= M187)
Q7Z4W1 L-xylulose reductase; XR; Carbonyl reductase II; Dicarbonyl/L-xylulose reductase; Kidney dicarbonyl reductase; kiDCR; Short chain dehydrogenase/reductase family 20C member 1; Sperm surface protein P34H; EC 1.1.1.10 from Homo sapiens (Human) (see 2 papers)
48% identity, 97% coverage: 7:244/245 of query aligns to 5:243/244 of Q7Z4W1
- 11:40 (vs. 13:42, 67% identical) binding
- N107 (= N108) mutation N->L,D: Loss of function. Probably due to defects in formation of the active site and binding of coenzyme.
- S136 (= S137) binding
- K153 (= K154) binding
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
Q920P0 L-xylulose reductase; XR; Dicarbonyl/L-xylulose reductase; EC 1.1.1.10 from Rattus norvegicus (Rat) (see paper)
49% identity, 97% coverage: 7:244/245 of query aligns to 5:243/244 of Q920P0
- S136 (= S137) mutation to A: Loss of activity.
- Q137 (= Q138) mutation to M: Slightly reduced activity. Loss of activity for sugars; when associated with F-143 and L-146.
- L143 (= L144) mutation to F: Slightly reduced activity. Loss of activity for sugars; when associated with M-137 and L-146.
- H146 (= H147) mutation to L: Slightly reduced activity. Loss of activity for sugars; when associated with M-137; F-143 and L-146.
- Y149 (= Y150) mutation to F: Loss of activity.
- K153 (= K154) mutation to M: Loss of activity.
- N190 (≠ A191) mutation to V: Slightly reduced activity. Loss of activity for sugars; when associated with S-191.
- W191 (= W192) mutation to F: Slightly reduced activity.; mutation to S: Slightly reduced activity. Loss of activity for sugars; when associated with V-190.
P08074 Carbonyl reductase [NADPH] 2; Adipocyte protein P27; AP27; Lung carbonyl reductase; LCR; NADPH-dependent carbonyl reductase 2; EC 1.1.1.184 from Mus musculus (Mouse) (see 2 papers)
46% identity, 98% coverage: 5:244/245 of query aligns to 3:243/244 of P08074
- 11:39 (vs. 13:41, 72% identical) binding
- T38 (≠ A40) mutation to R: Converts the coenzyme specificity from NADP to NAD.
1cydA Carbonyl reductase complexed with NADPH and 2-propanol (see paper)
46% identity, 98% coverage: 5:244/245 of query aligns to 1:241/242 of 1cydA
- active site: G16 (= G20), S134 (= S137), L144 (≠ H147), Y147 (= Y150), K151 (= K154)
- binding isopropyl alcohol: S134 (= S137), Y147 (= Y150), V188 (≠ A191)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), G14 (≠ S18), K15 (≠ S19), I17 (= I21), R37 (= R41), T38 (≠ N42), D58 (= D61), L59 (≠ V62), N81 (≠ C84), A83 (≠ G86), V104 (= V107), V132 (= V135), S134 (= S137), Y147 (= Y150), K151 (= K154), P177 (= P180), T178 (= T181), V179 (= V182), V180 (≠ T183), T182 (= T185), M184 (= M187), G185 (≠ A188)
5jlaD Crystal structure of ribose-5-phosphate isomerase from brucella melitensis 16m
38% identity, 98% coverage: 3:242/245 of query aligns to 1:244/259 of 5jlaD
- active site: G18 (= G20), S139 (= S137), L148 (≠ D146), Y151 (= Y150), K155 (= K154), H196 (≠ D194)
- binding nicotinamide-adenine-dinucleotide: G14 (= G16), S17 (= S19), G18 (= G20), I19 (= I21), D38 (≠ A40), R39 (= R41), L58 (= L60), D59 (= D61), V60 (= V62), C86 (= C84), A87 (= A85), I137 (≠ V135), S139 (= S137), Y151 (= Y150), K155 (= K154), P181 (= P180), G182 (≠ T181), F183 (≠ V182), T184 (= T183), T186 (= T185), A188 (≠ M187)
3lqfA Crystal structure of the short-chain dehydrogenase galactitol- dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD and erythritol (see paper)
38% identity, 98% coverage: 5:243/245 of query aligns to 7:252/254 of 3lqfA
- active site: G22 (= G20), S144 (= S137), Y159 (= Y150), K163 (= K154)
- binding meso-erythritol: N151 (≠ L144), Y159 (= Y150), Y191 (≠ V182), T197 (≠ A188), M200 (≠ A191)
- binding nicotinamide-adenine-dinucleotide: G18 (= G16), S21 (= S19), G22 (= G20), I23 (= I21), D42 (≠ A40), R43 (= R41), D66 (= D61), V67 (= V62), S92 (≠ C84), L142 (≠ V135), S144 (= S137), K163 (= K154), P189 (= P180), V192 (≠ T183), T194 (= T185), M196 (= M187), T197 (≠ A188)
2wsbA Crystal structure of the short-chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD (see paper)
38% identity, 98% coverage: 5:243/245 of query aligns to 7:252/254 of 2wsbA
- active site: G22 (= G20), S144 (= S137), Y159 (= Y150), K163 (= K154)
- binding nicotinamide-adenine-dinucleotide: G18 (= G16), S21 (= S19), G22 (= G20), I23 (= I21), D42 (≠ A40), R43 (= R41), D66 (= D61), V67 (= V62), S92 (≠ C84), A93 (= A85), L142 (≠ V135), S144 (= S137), Y159 (= Y150), K163 (= K154), P189 (= P180), V192 (≠ T183), T194 (= T185), M196 (= M187), T197 (≠ A188)
- binding n-propanol: S144 (= S137), M145 (≠ Q138), N151 (≠ L144), N151 (≠ L144), Y159 (= Y150), Y159 (= Y150), Y191 (≠ V182)
2wdzA Crystal structure of the short chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with NAD+ and 1,2-pentandiol (see paper)
38% identity, 98% coverage: 5:243/245 of query aligns to 7:252/254 of 2wdzA
- active site: G22 (= G20), S144 (= S137), Y159 (= Y150), K163 (= K154)
- binding (2S)-pentane-1,2-diol: A45 (≠ V43), D49 (≠ A47), R62 (≠ P57), S146 (≠ A139), Y159 (= Y150)
- binding nicotinamide-adenine-dinucleotide: G18 (= G16), S21 (= S19), G22 (= G20), I23 (= I21), D42 (≠ A40), R43 (= R41), A65 (≠ L60), D66 (= D61), V67 (= V62), S92 (≠ C84), A93 (= A85), L142 (≠ V135), S144 (= S137), Y159 (= Y150), K163 (= K154), P189 (= P180), V192 (≠ T183), T194 (= T185), M196 (= M187), T197 (≠ A188)
C0KTJ6 Galactitol 2-dehydrogenase (L-tagatose-forming); Galactitol dehydrogenase; GDH; GatDH; Galactitol:NAD(+) 5-oxidoreductase; EC 1.1.1.406 from Cereibacter sphaeroides (Rhodobacter sphaeroides) (see paper)
38% identity, 98% coverage: 5:243/245 of query aligns to 7:252/254 of C0KTJ6
Sites not aligning to the query:
1ae1B Tropinone reductase-i complex with NADP (see paper)
36% identity, 98% coverage: 5:244/245 of query aligns to 2:254/258 of 1ae1B
- active site: G17 (= G20), S143 (= S137), V153 (≠ H147), Y156 (= Y150), K160 (= K154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G16), S15 (= S18), K16 (≠ S19), G17 (= G20), I18 (= I21), S37 (≠ A40), R38 (= R41), C62 (≠ L60), D63 (= D61), L64 (≠ V62), N91 (≠ C84), A92 (= A85), S143 (= S137), Y156 (= Y150), K160 (= K154), P186 (= P180), I189 (≠ T183), T191 (= T185), L193 (≠ M187), V194 (≠ A188)
P50162 Tropinone reductase 1; Tropine dehydrogenase; Tropinone reductase I; TR-I; EC 1.1.1.206 from Datura stramonium (Jimsonweed) (Common thornapple) (see paper)
36% identity, 98% coverage: 5:245/245 of query aligns to 17:270/273 of P50162
- 25:49 (vs. 13:37, 60% identical) binding
- S158 (= S137) binding
- Y171 (= Y150) active site, Proton acceptor
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
35% identity, 98% coverage: 5:244/245 of query aligns to 2:251/252 of 1vl8B
- active site: G17 (= G20), S143 (= S137), I154 (≠ H147), Y157 (= Y150), K161 (= K154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G16), R16 (≠ S19), G17 (= G20), L18 (≠ I21), S37 (≠ A40), R38 (= R41), C63 (vs. gap), D64 (= D61), V65 (= V62), A91 (≠ C84), A92 (= A85), G93 (= G86), I94 (= I87), V114 (= V107), I141 (≠ V135), S143 (= S137), Y157 (= Y150), K161 (= K154), P187 (= P180), G188 (≠ T181), Y190 (≠ T183), T192 (= T185), M194 (= M187), T195 (≠ A188)
4b79A The aeropath project and pseudomonas aeruginosa high-throughput crystallographic studies for assessment of potential targets in early stage drug discovery. (see paper)
37% identity, 96% coverage: 7:242/245 of query aligns to 8:233/236 of 4b79A
- active site: G21 (= G20), S133 (= S137), R143 (≠ H147), Y146 (= Y150), K150 (= K154)
- binding nicotinamide-adenine-dinucleotide: G17 (= G16), S19 (= S18), S20 (= S19), G21 (= G20), I22 (= I21), L42 (≠ R41), L60 (= L60), D61 (= D61), I62 (≠ V62), N84 (≠ C84), G86 (= G86), L105 (≠ V107), I131 (≠ V135), Y146 (= Y150), K150 (= K154), P176 (= P180), G177 (≠ T181), I179 (≠ T183), T181 (= T185)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
31% identity, 98% coverage: 5:245/245 of query aligns to 3:255/255 of 5itvA
- active site: G18 (= G20), S141 (= S137), Y154 (= Y150), K158 (= K154)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G16), S17 (= S19), G18 (= G20), I19 (= I21), D38 (≠ A40), I39 (≠ R41), T61 (≠ L60), I63 (≠ V62), N89 (≠ C84), G91 (= G86), T139 (≠ V135), S141 (= S137), Y154 (= Y150), K158 (= K154), P184 (= P180), G185 (≠ T181), I186 (≠ V182), I187 (≠ T183)
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
35% identity, 95% coverage: 10:241/245 of query aligns to 6:250/256 of 7do7A
- active site: G16 (= G20), S146 (= S137), Y159 (= Y150)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), R15 (≠ S19), G16 (= G20), I17 (= I21), S37 (≠ R41), D66 (≠ E56), A67 (≠ P57), N93 (≠ C84), A94 (= A85), G95 (= G86), I96 (= I87), V144 (= V135), S145 (= S136), S146 (= S137), Y159 (= Y150), K163 (= K154), P189 (= P180), G190 (≠ T181), I192 (≠ T183), T194 (= T185), I196 (≠ M187)
- binding beta-L-rhamnopyranose: F99 (≠ L90), S146 (= S137), S148 (≠ A139), Q156 (≠ H147), Y159 (= Y150), N197 (≠ A188), D235 (≠ G226), M236 (≠ G227), R238 (≠ S229)
7b81A Crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase (NAD bound-form) (see paper)
35% identity, 95% coverage: 10:241/245 of query aligns to 6:250/256 of 7b81A
- active site: G16 (= G20), S146 (= S137), Y159 (= Y150)
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), S14 (= S18), R15 (≠ S19), I17 (= I21), D66 (≠ E56), A67 (≠ P57), N93 (≠ C84), A94 (= A85), G95 (= G86), I96 (= I87), T116 (≠ V107), V144 (= V135), S146 (= S137), Y159 (= Y150), K163 (= K154), P189 (= P180), G190 (≠ T181), I192 (≠ T183), T194 (= T185), I196 (≠ M187)
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
35% identity, 96% coverage: 6:241/245 of query aligns to 3:237/241 of 5t2uA
- active site: G17 (= G20), T135 (≠ S137), T145 (≠ H147), Y148 (= Y150), K152 (= K154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G16), G17 (= G20), R38 (= R41), D39 (≠ N42), R42 (≠ E45), D60 (= D61), L61 (≠ V62), N83 (≠ C84), A84 (= A85), Y87 (≠ A88), I133 (≠ V135), T135 (≠ S137), Y148 (= Y150), K152 (= K154), P178 (= P180), P180 (≠ V182), T181 (= T183), T183 (= T185), T185 (≠ M187), T186 (≠ A188)
Q9LBG2 Levodione reductase; (6R)-2,2,6-trimethyl-1,4-cyclohexanedione reductase; EC 1.1.1.- from Leifsonia aquatica (Corynebacterium aquaticum) (see paper)
34% identity, 98% coverage: 4:244/245 of query aligns to 8:265/267 of Q9LBG2
- 17:42 (vs. 13:34, 50% identical) binding
- E103 (≠ A88) mutation E->A,D,N,Q: 26-fold increase in Km and a much lower enantiomeric excess of the reaction products.
Query Sequence
>BPHYT_RS16040 FitnessBrowser__BFirm:BPHYT_RS16040
MNATFDFSGRSILVTGASSGIGRATVEALCASGANVVAAARNVSELARLAEETGCEPLVL
DVSDEAAIDDALGSLDVFDGLVNCAGIALLERAVDTTGASFDRVMAVNARGAVLVAKHVA
RGMIDAQRGGSIVNVSSQAALVALDDHLSYSASKAALDAVTRALCVELGPFGIRVNSVNP
TVTLTPMAVLAWSDPVKRDPALKAIPLGRFAESAEVAAPILFLLSGGASMISGVCLAVDG
GYTAR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory