Comparing BPHYT_RS16060 FitnessBrowser__BFirm:BPHYT_RS16060 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
43% identity, 94% coverage: 1:476/506 of query aligns to 1:473/501 of P04983
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
32% identity, 43% coverage: 4:220/506 of query aligns to 2:215/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 42% coverage: 7:220/506 of query aligns to 4:215/240 of 4ymuJ
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
32% identity, 43% coverage: 4:221/506 of query aligns to 3:218/223 of 2pclA
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 43% coverage: 4:220/506 of query aligns to 3:216/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
30% identity, 43% coverage: 4:220/506 of query aligns to 3:216/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
30% identity, 43% coverage: 4:220/506 of query aligns to 3:216/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
30% identity, 43% coverage: 4:220/506 of query aligns to 3:216/242 of 2oljA
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 43% coverage: 4:220/506 of query aligns to 4:229/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 43% coverage: 4:220/506 of query aligns to 4:229/253 of 1g9xB
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
27% identity, 48% coverage: 1:242/506 of query aligns to 1:231/285 of 4yerA
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
32% identity, 43% coverage: 1:220/506 of query aligns to 1:222/648 of P75831
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
25% identity, 55% coverage: 4:279/506 of query aligns to 1:288/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
25% identity, 55% coverage: 4:279/506 of query aligns to 2:289/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
25% identity, 55% coverage: 4:279/506 of query aligns to 2:289/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
25% identity, 55% coverage: 4:279/506 of query aligns to 2:289/344 of 6cvlD
5x40A Structure of a cbio dimer bound with amppcp (see paper)
31% identity, 51% coverage: 1:259/506 of query aligns to 1:250/280 of 5x40A
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
30% identity, 53% coverage: 5:271/506 of query aligns to 7:274/375 of 2d62A
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
33% identity, 42% coverage: 5:218/506 of query aligns to 4:211/369 of P19566
Sites not aligning to the query:
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
32% identity, 42% coverage: 5:218/506 of query aligns to 3:210/374 of 2awnB
>BPHYT_RS16060 FitnessBrowser__BFirm:BPHYT_RS16060
MDTILKLDNITKSFPGVKALQGIHLEIERGEIHALLGENGAGKSTLMKILCGIYQPDEGT
ITIEGEARHFSNYHDAVAAGVGIVFQEFSLIPYLNAVENMFLGRELKNGLGLLERGKMRR
AAAAIFQRLGVTIDLSVPIRELSVAQQQFVEIGKALSLEARILILDEPTATLTPAEAEHL
FAIMRELKQQGVAMIFISHHLEEIFEVCDRITVLRDGQYVGMTEVAQSNVGHLVEMMVGR
RIENSFPPKPPLRADAKIVLDVEKLQLLKDSPVLSFTLREGEILGFAGLVGSGRTETALA
VIGADPAYVKEIRINGTAAKLSDPADALRAGVGILPESRKTEGLITDFSIKQNISINNLG
KYRSLRFFIDQRSEARATADIMKRVGVKAPTMHTEVATLSGGNQQKVVIARWLNHHTNIL
IFDEPTRGIDVGAKAEIYLLMRELTARGYSIIMISSELPEIVGMCDRVAVFRQGRIEAML
EGDAIDSNAVMTYATAGSRGATHEHP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory