Comparing BPHYT_RS16065 FitnessBrowser__BFirm:BPHYT_RS16065 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
38% identity, 85% coverage: 43:313/317 of query aligns to 3:274/274 of 2ioyA
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
32% identity, 88% coverage: 38:317/317 of query aligns to 6:284/284 of 7e7mC
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
33% identity, 86% coverage: 42:315/317 of query aligns to 4:287/287 of 5dteB
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
34% identity, 85% coverage: 43:310/317 of query aligns to 4:271/271 of 1dbpA
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
30% identity, 87% coverage: 42:316/317 of query aligns to 3:287/292 of 2fn8A
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
32% identity, 84% coverage: 43:307/317 of query aligns to 5:268/270 of 4zjpA
4irxA Crystal structure of caulobacter myo-inositol binding protein bound to myo-inositol (see paper)
32% identity, 80% coverage: 41:294/317 of query aligns to 9:270/296 of 4irxA
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
30% identity, 83% coverage: 45:308/317 of query aligns to 6:282/288 of 1rpjA
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
30% identity, 83% coverage: 45:308/317 of query aligns to 6:282/288 of 1gudA
Sites not aligning to the query:
4ry9B Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
30% identity, 87% coverage: 41:315/317 of query aligns to 3:290/297 of 4ry9B
4ry9A Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
30% identity, 87% coverage: 41:315/317 of query aligns to 3:290/297 of 4ry9A
8wlbA X-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose (see paper)
29% identity, 83% coverage: 45:308/317 of query aligns to 6:282/288 of 8wlbA
8wl9A X-ray structure of enterobacter cloacae allose-binding protein in complex with d-ribose (see paper)
29% identity, 83% coverage: 45:308/317 of query aligns to 6:282/288 of 8wl9A
5hqjA Crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose
33% identity, 56% coverage: 53:231/317 of query aligns to 18:199/289 of 5hqjA
Sites not aligning to the query:
2rjoA Crystal structure of twin-arginine translocation pathway signal protein from burkholderia phytofirmans
31% identity, 69% coverage: 43:262/317 of query aligns to 6:239/322 of 2rjoA
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
29% identity, 91% coverage: 11:297/317 of query aligns to 3:290/349 of A0QYB5
2x7xA Fructose binding periplasmic domain of hybrid two component system bt1754 (see paper)
26% identity, 79% coverage: 62:312/317 of query aligns to 23:276/301 of 2x7xA
Sites not aligning to the query:
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
27% identity, 70% coverage: 43:263/317 of query aligns to 9:234/287 of 4yo7A
Sites not aligning to the query:
6hyhA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-fucofuranose (see paper)
28% identity, 64% coverage: 60:261/317 of query aligns to 21:234/304 of 6hyhA
Sites not aligning to the query:
6hbmA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with alpha-l-arabinofuranose (see paper)
28% identity, 64% coverage: 60:261/317 of query aligns to 21:234/304 of 6hbmA
Sites not aligning to the query:
>BPHYT_RS16065 FitnessBrowser__BFirm:BPHYT_RS16065
MTQSLSKPTSLKTFARSTAALATLAFGLSFIAAPAAQAAPLKIGMTFQELNNPYFVTMQK
ALNDAAASIGATVVVTDAHHDVSKQVSDVEDMLQKKIDILLVNPTDSTGIQSAVTSAKKA
GVVVVAVDANANGPVDSFVGSKNYDAGEMACEYLAKSIGGSGEVAILDGIPVVPILERVR
GCKAALAKAPGVKLVDTQNGKQERATALSVTENMIQAHPNLKGVFSVNDGGSMGALSAIE
SSGKDIKLTSVDGAPEAIAAIQKPNSKFVETSAQFPADQVRIALGIALAKKWGANVPKTI
PVDVKMIDKSNAKGFSW
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory