Comparing BPHYT_RS16105 FitnessBrowser__BFirm:BPHYT_RS16105 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
P94530 Arabinooligosaccharides transport system permease protein AraQ from Bacillus subtilis (strain 168) (see paper)
26% identity, 93% coverage: 20:291/291 of query aligns to 4:280/281 of P94530
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
34% identity, 70% coverage: 88:291/291 of query aligns to 86:295/296 of P68183
>BPHYT_RS16105 FitnessBrowser__BFirm:BPHYT_RS16105
MSQVASTPVSNPTAMTVPAKSPFAAIRRGIPGVIAWLVALLLFFPIFWMTITAFKTEQQA
YASSLFFIPTLDSFREVFARSNYFSFAWNSILISAGVTILCLILAVPAAYAMAFFPTRRT
QKVLLWMLSTKMMPSVGVLVPIYLLWKNSGLLDSVSGLVIVYTLINLPIAVWMSFTYFAE
IPRDILEAGRIDGAATWQEIVYLLMPMSLPGLASTALLLVILSWNEAFWSINLSSSNAAP
LTVFIASYSSPEGLFWAKLSAASLLAVAPILIVGWLSQKQLVRGLTFGAVK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory