Comparing BPHYT_RS16110 FitnessBrowser__BFirm:BPHYT_RS16110 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
28% identity, 94% coverage: 16:307/311 of query aligns to 2:285/285 of 7cagA
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
25% identity, 91% coverage: 1:283/311 of query aligns to 1:288/313 of P94529
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
30% identity, 69% coverage: 93:306/311 of query aligns to 289:512/514 of P02916
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
31% identity, 61% coverage: 93:281/311 of query aligns to 274:474/490 of 4ki0F
>BPHYT_RS16110 FitnessBrowser__BFirm:BPHYT_RS16110
MRPLRLPIMHAHPQTEKERETRKANSARWLATPSVAVLVLWMAIPLAMTIWFSFSRYNLL
NPDLKGFAGFDNYKYLASDPSFGPSIGHTLELIISVLVITVVGGVLMAILFDRKFYGQGI
ARLLAIAPFFVMPTVSALIWKNMILHPVYGLIAQGMRAMGMQPIDWFAEYPLTAVIMIVA
WQWLPFAFLILFTAIQSLDQEQKEAARIDGAGPFSMFFYITLPHLKRAIAVVVMMETIFL
LSIFAEIYTTTGGGPGTATTNLSYLIYSLGLQQFDVGLASAGGILAVVLANIVSFFLVRM
LAKNLKGEYEK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory