Comparing BPHYT_RS16115 FitnessBrowser__BFirm:BPHYT_RS16115 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ryaA Crystal structure of abc transporter solute binding protein avi_3567 from agrobacterium vitis s4, target efi-510645, with bound d-mannitol
61% identity, 94% coverage: 26:440/440 of query aligns to 1:417/417 of 4ryaA
5iaiA Crystal structure of abc transporter solute binding protein arad_9887 from agrobacterium radiobacter k84, target efi-510945 in complex with ribitol
27% identity, 90% coverage: 28:421/440 of query aligns to 7:391/399 of 5iaiA
1eu8A Structure of trehalose maltose binding protein from thermococcus litoralis (see paper)
27% identity, 93% coverage: 29:435/440 of query aligns to 6:407/407 of 1eu8A
Q7LYW7 Trehalose/maltose-binding protein MalE; TMBP from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) (see paper)
26% identity, 93% coverage: 29:435/440 of query aligns to 47:448/450 of Q7LYW7
6dtqA Maltose bound t. Maritima male3 (see paper)
27% identity, 73% coverage: 42:363/440 of query aligns to 18:335/391 of 6dtqA
Sites not aligning to the query:
A9CEY9 Sulfoquinovosyl glycerol-binding protein SmoF; SQGro-binding protein SmoF; SQ monooxygenase cluster protein F from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see 2 papers)
25% identity, 93% coverage: 8:417/440 of query aligns to 2:399/416 of A9CEY9
7qhvAAA Sulfoquinovosyl binding protein (see paper)
25% identity, 88% coverage: 29:417/440 of query aligns to 6:369/390 of 7qhvAAA
7ofyA Crystal structure of sq binding protein from agrobacterium tumefaciens in complex with sulfoquinovosyl glycerol (sqgro) (see paper)
25% identity, 88% coverage: 29:417/440 of query aligns to 7:371/389 of 7ofyA
7yzsAAA Sulfoquinovosyl binding protein (see paper)
25% identity, 88% coverage: 29:417/440 of query aligns to 5:369/384 of 7yzsAAA
7yzuA Crystal structure of the sulfoquinovosyl binding protein smof complexed with sqme (see paper)
25% identity, 88% coverage: 29:417/440 of query aligns to 4:366/382 of 7yzuA
5ci5A Crystal structure of an abc transporter solute binding protein from thermotoga lettingae tmo (tlet_1705, target efi-510544) bound with alpha-d-tagatose
29% identity, 53% coverage: 93:327/440 of query aligns to 69:303/393 of 5ci5A
Sites not aligning to the query:
3k02A Crystal structures of the gach receptor of streptomyces glaucescens gla.O in the unliganded form and in complex with acarbose and an acarbose homolog. Comparison with acarbose-loaded maltose binding protein of salmonella typhimurium. (see paper)
26% identity, 69% coverage: 26:329/440 of query aligns to 3:299/388 of 3k02A
Sites not aligning to the query:
3jzjA Crystal structures of the gach receptor of streptomyces glaucescens gla.O in the unliganded form and in complex with acarbose and an acarbose homolog. Comparison with acarbose-loaded maltose binding protein of salmonella typhimurium. (see paper)
26% identity, 69% coverage: 26:329/440 of query aligns to 3:299/388 of 3jzjA
Sites not aligning to the query:
4r9gA Cpmnbp1 with mannotriose bound (see paper)
25% identity, 67% coverage: 37:331/440 of query aligns to 13:312/394 of 4r9gA
Sites not aligning to the query:
5f7vA Abc substrate-binding protein lmo0181 from listeria monocytogenes in complex with cycloalternan (see paper)
26% identity, 73% coverage: 42:362/440 of query aligns to 17:344/388 of 5f7vA
Sites not aligning to the query:
1eljA The crystal structure of liganded maltodextrin-binding protein from pyrococcus furiosus (see paper)
22% identity, 73% coverage: 22:343/440 of query aligns to 1:306/380 of 1eljA
Sites not aligning to the query:
4r9fA Cpmnbp1 with mannobiose bound (see paper)
26% identity, 67% coverage: 37:331/440 of query aligns to 14:320/402 of 4r9fA
Sites not aligning to the query:
8artB Abc transporter binding protein male from streptomyces scabiei in complex with maltose
26% identity, 67% coverage: 43:335/440 of query aligns to 22:310/393 of 8artB
Sites not aligning to the query:
7ehpA Chitin oligosaccharide binding protein (see paper)
22% identity, 87% coverage: 42:422/440 of query aligns to 20:382/397 of 7ehpA
Sites not aligning to the query:
2i58A Crystal structure of rafe from streptococcus pneumoniae complexed with raffinose
29% identity, 36% coverage: 27:184/440 of query aligns to 1:154/385 of 2i58A
Sites not aligning to the query:
>BPHYT_RS16115 FitnessBrowser__BFirm:BPHYT_RS16115
MKPALKSTLKAVSAGAVACFALSASAATVTIATLNNPDMIELKKLSPEFEKANPDIKLNW
VILEENVLRQRATTDITTGSGQFDVMTIGAYETPQWGKRGWLTPLTNLPADYDLNDVVKT
ARDGLSSGGQLYALPFYVESSMTYYRKDLFEKAGLKMPDQPTYDQIKQFADKLTDKANGI
YGICLRGKAGWGENMAYGTTVVNTFGGRWFDEKWNAQLTSPEWKKAMTFYVDLLKKDGPP
GASSNGFNENLTLMSSGKCAMWIDATVAAGMLYNKQQSQIADKVGFAAAPVAVTPKGSHW
LWAWALAIPKSSKQADAAKKFITWATSKQYIELVAKDEGWASVPPGTRKSTYARAEYKQA
APFGDFVLKAIETADPEHPTLKPVPYTGVQFVGIPEFQSFGTVVGQSISGAIAGQMTIDQ
ALAAGNATADRAVKQAGYQK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory