Comparing BPHYT_RS16155 FitnessBrowser__BFirm:BPHYT_RS16155 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09099 Xylulose kinase; XK; Xylulokinase; 1-deoxy-D-xylulokinase; EC 2.7.1.17; EC 2.7.1.- from Escherichia coli (strain K12) (see paper)
31% identity, 98% coverage: 3:483/493 of query aligns to 2:479/484 of P09099
2itmA Crystal structure of the e. Coli xylulose kinase complexed with xylulose (see paper)
30% identity, 98% coverage: 3:483/493 of query aligns to 2:471/476 of 2itmA
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
25% identity, 98% coverage: 3:483/493 of query aligns to 4:478/490 of 3ll3B
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
24% identity, 98% coverage: 3:483/493 of query aligns to 5:480/492 of 3ll3A
3i8bA The crystal structure of xylulose kinase from bifidobacterium adolescentis
29% identity, 85% coverage: 5:421/493 of query aligns to 8:451/506 of 3i8bA
3kzbA Crystal structure of xylulokinase from chromobacterium violaceum
28% identity, 84% coverage: 6:421/493 of query aligns to 9:429/498 of 3kzbA
6jafA Crystal structure of trypanosoma brucei gambiense glycerol kinase complex with ppi (pyrophosphatase reaction)
24% identity, 85% coverage: 1:421/493 of query aligns to 3:443/513 of 6jafA
6j9qA Crystal structure of trypanosoma brucei gambiense glycerol kinase complex with amp-pnp.
24% identity, 85% coverage: 1:421/493 of query aligns to 3:443/513 of 6j9qA
5gn6A Crystal structure of glycerol kinase from trypanosoma brucei gambiense complexed with cumarin derivative-17b (see paper)
24% identity, 85% coverage: 1:421/493 of query aligns to 3:443/513 of 5gn6A
5gn5A Crystal structure of glycerol kinase from trypanosoma brucei gambiense complexed with cumarin derivative-17 (see paper)
24% identity, 85% coverage: 1:421/493 of query aligns to 3:443/513 of 5gn5A
5aziA Crystal structure of glycerol kinase from trypanosoma brucei gambiense complexed with 4np (see paper)
24% identity, 85% coverage: 1:421/493 of query aligns to 3:443/513 of 5aziA
3wxlA Crystal structure of trypanosoma brucei gambiense glycerol kinase complex with adp, mg2+, and glycerol (see paper)
24% identity, 85% coverage: 1:421/493 of query aligns to 3:443/513 of 3wxlA
3wxjB Crystal structure of trypanosoma brucei gambiense glycerol kinase in complex with glycerol 3-phosphate (see paper)
24% identity, 85% coverage: 1:421/493 of query aligns to 3:443/513 of 3wxjB
Q9NJP9 Glycerol kinase, glycosomal; GK; Glycerokinase; ATP:glycerol 3-phosphotransferase; EC 2.7.1.30 from Trypanosoma brucei brucei (see 2 papers)
24% identity, 85% coverage: 1:421/493 of query aligns to 1:441/512 of Q9NJP9
Q5HGD2 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Staphylococcus aureus (strain COL)
23% identity, 96% coverage: 3:475/493 of query aligns to 5:483/498 of Q5HGD2
3ge1A 2.7 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with adp and glycerol
23% identity, 96% coverage: 3:475/493 of query aligns to 6:484/499 of 3ge1A
1gllO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
25% identity, 91% coverage: 3:449/493 of query aligns to 5:453/494 of 1gllO
1gljO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
25% identity, 91% coverage: 3:449/493 of query aligns to 5:453/494 of 1gljO
1bwfO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
25% identity, 91% coverage: 3:449/493 of query aligns to 5:453/494 of 1bwfO
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
24% identity, 95% coverage: 4:472/493 of query aligns to 2:465/485 of 6k76A
>BPHYT_RS16155 FitnessBrowser__BFirm:BPHYT_RS16155
MSFLGIDLGTGSLKVAIVDENGREQAVASVAYPIETPQAGWAETSVQTWWRALCEAAARL
PDGLRRDVRAIGFSGQMHGVVLIDAAGEAVRPAMLWPDTRALALLEAWPEPQPNPVAPGM
AGPLLRWIVLHEPQSASRTRWALQPKDWLRVALGGAVATDPSDACATALADPAGVWDAAL
LDRLEIPHEWFAPLAPSYAAGGVLSESAARALGLRAGIVLATGAADTPCAALGSGLAHDG
DALLTTGTGGQIVVLAEHAPAAVKGLHRYRAASDHWYRMAAMQNVGIALERARGWLSYEW
ADAYRDAFGDATNATNATNATATFSANTAAASGLTFLPYLTGERTPWLNPMARGGWLGLA
LDHTRGTMMRAAFEGVAFSLRAGLDAIRASGATVTALKLAGGGSVDARWRQLLADALNVE
LHAVDCPNAAPRGAAILGGLASGHWHARDLAALAPGATRVAGPQGDAALAERYERFLDLY
GRIETWFTDTPSQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory