Comparing BPHYT_RS16375 FitnessBrowser__BFirm:BPHYT_RS16375 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
24% identity, 41% coverage: 13:238/552 of query aligns to 34:268/583 of Q9Y7Q9
Sites not aligning to the query:
O42885 Putative inorganic phosphate transporter C8E4.01c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 41% coverage: 10:233/552 of query aligns to 37:277/572 of O42885
Sites not aligning to the query:
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
26% identity, 28% coverage: 72:224/552 of query aligns to 187:325/616 of P36035
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
26% identity, 36% coverage: 29:227/552 of query aligns to 52:229/444 of Q8NLB7
Sites not aligning to the query:
P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
22% identity, 56% coverage: 16:322/552 of query aligns to 61:428/587 of P25297
Sites not aligning to the query:
Q09852 Putative inorganic phosphate transporter C23D3.12 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
21% identity, 57% coverage: 13:327/552 of query aligns to 38:423/559 of Q09852
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
30% identity, 26% coverage: 76:221/552 of query aligns to 204:346/727 of Q9Z2I6
Sites not aligning to the query:
Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
30% identity, 26% coverage: 76:221/552 of query aligns to 204:346/727 of Q496J9
Sites not aligning to the query:
8fvzA Pipt y150a
24% identity, 56% coverage: 17:323/552 of query aligns to 2:316/433 of 8fvzA
Sites not aligning to the query:
6rw3A The molecular basis for sugar import in malaria parasites. (see paper)
27% identity, 28% coverage: 88:239/552 of query aligns to 71:212/437 of 6rw3A
Sites not aligning to the query:
O08966 Solute carrier family 22 member 1; Organic cation transporter 1; mOCT1 from Mus musculus (Mouse) (see paper)
27% identity, 31% coverage: 75:247/552 of query aligns to 162:313/556 of O08966
Sites not aligning to the query:
>BPHYT_RS16375 FitnessBrowser__BFirm:BPHYT_RS16375
MATVGGQISHVPMTREEKRVIFASSLGTVFEWYDFYLAGSLAAFISKSFFSGVNPTAAFI
FTLLSFAAGFAVRPFGAIVFGRLGDMVGRKYTFLVTIVIMGLSTFLVGFLPGYASIGFAS
PVIFIAMRMLQGLALGGEYGGAATYVAEHAPAGRRGFYTAWIQTTATLGLFLSLLVILGV
RTAMGEDAFGDWGWRIPFIVSILLLAVSVWIRLQLHESPVFERIKSEGKTSKAPLTEAFG
QWKNLKIVILALIGLTAGQAVVWYTGQFYTLFFLTQTLKVDGSSANIMIAIALLIGTPFF
LFFGSLSDRIGRKPIIMAGLLIAACTYFPLFKALAHYTNPALEAATAKAPIVVIANPDEC
SFQFNPVGTAKFTSSCDIAKSALSKAGLNYENVAAPAGTLAQIKVGDTVINTYDGKAADA
KDQGKAFDKTLATTLKTAGYAPKADPTQINWPMTVVILTIMMIYVTMVYGPIAAMLVEMF
PTRIRYTSMSLPYHIGNGWFGGFLPATAFAIVAAKGNIFSGLWYPIVIALVTFVIGMLFV
RETKDSDIYAKD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory