Comparing BPHYT_RS16460 FitnessBrowser__BFirm:BPHYT_RS16460 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
24% identity, 79% coverage: 41:403/457 of query aligns to 56:388/444 of Q8NLB7
Sites not aligning to the query:
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
22% identity, 39% coverage: 83:258/457 of query aligns to 98:279/583 of Q9Y7Q9
Sites not aligning to the query:
O23492 Inositol transporter 4; Myo-inositol-proton symporter INT4; Protein INOSITOL TRANSPORTER 4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 53% coverage: 92:332/457 of query aligns to 91:349/582 of O23492
Sites not aligning to the query:
>BPHYT_RS16460 FitnessBrowser__BFirm:BPHYT_RS16460
MQTHASPSATASPHSAQAPLSKAMVRRIVFSSSVGNALEWFDFLVYGYFATIIAKEFFPM
KDEWLSTLLAIATFGISFLMRPLGAVVLGIYGDRKGRKAALTLAIALMMVGTFTMAVMPP
YASIGIAAPILILLARLVQGFAVGGEFGSATAFMVEHSASRRGYYASWQFASQGLAAITA
AAFGSLLTAWMPPAQLNDWGWRLPFVFGLLVGPVGYYIRSHLDETPEFLALREAREAREV
AGARSTASEEKDASFASQWVNLLLAVGIVAQSTVGVYVLQLYMPMYAVKQLHMPAAASFG
VVVLNGGLQFLLSPVMGALSDRIGRIRIMLTTSILMGTLIYPMFALLQSHPTIGWLLLLQ
GTAGIFKAAYSGPMPALMSEIFPTQVRSTGLSIGYSIGVTIFGGFAPTIVETFIHLTGDK
LAPSYYVLIAAVLSGLSLAVVAWRMRRVRLMHGVQIA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory