Comparing BPHYT_RS16500 FitnessBrowser__BFirm:BPHYT_RS16500 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3c02A X-ray structure of the aquaglyceroporin from plasmodium falciparum (see paper)
33% identity, 97% coverage: 1:231/237 of query aligns to 3:231/242 of 3c02A
B1VB61 Propanediol uptake facilitator PduF from Citrobacter freundii (see paper)
35% identity, 97% coverage: 5:234/237 of query aligns to 10:252/269 of B1VB61
P37451 Propanediol uptake facilitator PduF from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
34% identity, 97% coverage: 6:234/237 of query aligns to 11:252/264 of P37451
6f7hC Crystal structure of human aqp10 (see paper)
31% identity, 97% coverage: 5:234/237 of query aligns to 10:248/253 of 6f7hC
Q96PS8 Aquaporin-10; AQP-10; Aquaglyceroporin-10; Small intestine aquaporin from Homo sapiens (Human) (see 2 papers)
31% identity, 97% coverage: 5:234/237 of query aligns to 25:263/301 of Q96PS8
P0AER0 Glycerol uptake facilitator protein; Aquaglyceroporin; Glycerol facilitator from Escherichia coli (strain K12) (see 3 papers)
36% identity, 97% coverage: 5:234/237 of query aligns to 12:254/281 of P0AER0
1fx8A Crystal structure of the e. Coli glycerol facilitator (glpf) with substrate glycerol (see paper)
36% identity, 97% coverage: 5:234/237 of query aligns to 7:249/254 of 1fx8A
I1CR68 Aquaporin-1 from Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) (Mucormycosis agent) (Rhizopus arrhizus var. delemar) (see paper)
33% identity, 93% coverage: 4:224/237 of query aligns to 61:289/306 of I1CR68
8c9hA Aqp7_inhibitor
31% identity, 98% coverage: 1:232/237 of query aligns to 9:248/253 of 8c9hA
6n1gA Crystal structure of aquaglyceroporin aqp7 (see paper)
31% identity, 98% coverage: 1:232/237 of query aligns to 3:242/249 of 6n1gA
O14520 Aquaporin-7; AQP-7; Aquaglyceroporin-7; Aquaporin adipose; AQPap; Aquaporin-7-like from Homo sapiens (Human) (see 4 papers)
31% identity, 97% coverage: 4:232/237 of query aligns to 37:273/342 of O14520
Sites not aligning to the query:
2evuA Crystal structure of aquaporin aqpm at 2.3a resolution (see paper)
31% identity, 97% coverage: 5:234/237 of query aligns to 9:243/245 of 2evuA
P08995 Nodulin-26; N-26 from Glycine max (Soybean) (Glycine hispida) (see paper)
27% identity, 92% coverage: 5:223/237 of query aligns to 41:240/271 of P08995
Sites not aligning to the query:
Q9XF58 Aquaporin PIP2-5; Plasma membrane intrinsic protein 2-5; ZmPIP2-5; ZmPIP2;5; ZmPIP2a from Zea mays (Maize) (see paper)
30% identity, 97% coverage: 5:234/237 of query aligns to 40:269/285 of Q9XF58
Q6Z2T3 Aquaporin NIP2-1; Low silicon protein 1; NOD26-like intrinsic protein 2-1; OsNIP2;1; Silicon influx transporter LSI1 from Oryza sativa subsp. japonica (Rice) (see paper)
29% identity, 97% coverage: 5:235/237 of query aligns to 52:258/298 of Q6Z2T3
P43287 Aquaporin PIP2-2; Plasma membrane intrinsic protein 2-2; AtPIP2;2; Plasma membrane intrinsic protein 2b; PIP2b; TMP2b from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
27% identity, 97% coverage: 5:234/237 of query aligns to 40:267/285 of P43287
Sites not aligning to the query:
P43286 Aquaporin PIP2-1; Plasma membrane intrinsic protein 2-1; AtPIP2;1; Plasma membrane intrinsic protein 2a; PIP2a from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
28% identity, 97% coverage: 5:234/237 of query aligns to 42:269/287 of P43286
Sites not aligning to the query:
Q9SAI4 Aquaporin NIP6-1; NOD26-like intrinsic protein 6-1; AtNIP6;1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 95% coverage: 6:231/237 of query aligns to 84:285/305 of Q9SAI4
P30302 Aquaporin PIP2-3; Plasma membrane intrinsic protein 2-3; AtPIP2;3; Plasma membrane intrinsic protein 2c; PIP2c; RD28-PIP; TMP2C; Water stress-induced tonoplast intrinsic protein; WSI-TIP from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 97% coverage: 5:234/237 of query aligns to 40:267/285 of P30302
P61837 Aquaporin PIP1-1; AtPIP1;1; Plasma membrane aquaporin-1; Plasma membrane intrinsic protein 1a; PIP1a from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 96% coverage: 5:232/237 of query aligns to 55:274/286 of P61837
Sites not aligning to the query:
>BPHYT_RS16500 FitnessBrowser__BFirm:BPHYT_RS16500
MSPYIAEFIGTALVVLLGDGAVANVLLARTKGKGADLIVIVMGWAMAVFIAVYVTASFSG
AHLNPVVTISLALAGKFAWAKVPGYIAAQMLGGMAGALLVWIAYRQHFAKEGDADVKLGV
FCTSPAIRSVPHNLLTEMIATFVLILGVLYLASPQVGLGALDALPVGLLVLGIGISLGGP
TGYAMSPARDLSPRLMHALLPIPGKRDSDWHYAWIPVCGPLLGGAAAACLYLYLHVH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory