Comparing BPHYT_RS16630 FitnessBrowser__BFirm:BPHYT_RS16630 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1h2fA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with trivanadate (see paper)
33% identity, 92% coverage: 3:207/223 of query aligns to 2:202/207 of 1h2fA
Sites not aligning to the query:
1h2eA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with phosphate (see paper)
33% identity, 92% coverage: 3:207/223 of query aligns to 2:202/207 of 1h2eA
P36623 Phosphoglycerate mutase; PGAM; BPG-dependent PGAM; MPGM; Phosphoglyceromutase; EC 5.4.2.11 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
31% identity, 77% coverage: 1:172/223 of query aligns to 1:193/211 of P36623
6m1xC Crystal structure of phosphoserine phosphatase in complex with 3- phosphoglyceric acid from entamoeba histolytica (see paper)
31% identity, 91% coverage: 3:206/223 of query aligns to 2:196/196 of 6m1xC
5zr2C Crystal structure of phosphoserine phosphatase mutant (h9a) from entamoeba histolytica in complex with phosphoserine (see paper)
30% identity, 91% coverage: 3:206/223 of query aligns to 2:196/198 of 5zr2C
4ij6A Crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from hydrogenobacter thermophilus tk-6 in complex with l-phosphoserine (see paper)
26% identity, 92% coverage: 2:206/223 of query aligns to 1:200/207 of 4ij6A
P62707 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Escherichia coli (strain K12) (see 6 papers)
28% identity, 81% coverage: 2:181/223 of query aligns to 3:215/250 of P62707
Sites not aligning to the query:
1e59A E.Coli cofactor-dependent phosphoglycerate mutase complexed with vanadate (see paper)
28% identity, 81% coverage: 2:181/223 of query aligns to 1:213/239 of 1e59A
P9WIC7 Glucosyl-3-phosphoglycerate phosphatase; Mannosyl-3-phosphoglycerate phosphatase; EC 3.1.3.85; EC 3.1.3.70 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
31% identity, 94% coverage: 4:212/223 of query aligns to 5:201/223 of P9WIC7
Sites not aligning to the query:
4pzaB The complex structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c with inorganic phosphate (see paper)
30% identity, 94% coverage: 4:212/223 of query aligns to 4:200/217 of 4pzaB
P00950 Phosphoglycerate mutase 1; PGAM 1; BPG-dependent PGAM 1; MPGM 1; Phosphoglyceromutase 1; EC 5.4.2.11 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 7 papers)
26% identity, 80% coverage: 4:181/223 of query aligns to 3:213/247 of P00950
Sites not aligning to the query:
5pgmE Saccharomyces cerevisiae phosphoglycerate mutase (see paper)
26% identity, 80% coverage: 4:181/223 of query aligns to 2:212/234 of 5pgmE
Sites not aligning to the query:
1bq4A Saccharomyces cerevisiae phosphoglycerate mutase in complex with benzene hexacarboxylate (see paper)
26% identity, 80% coverage: 4:181/223 of query aligns to 2:212/234 of 1bq4A
1bq3A Saccharomyces cerevisiae phosphoglycerate mutase in complex with inositol hexakisphosphate (see paper)
26% identity, 80% coverage: 4:181/223 of query aligns to 2:212/234 of 1bq3A
1qhfA Yeast phosphoglycerate mutase-3pg complex structure to 1.7 a (see paper)
26% identity, 80% coverage: 4:181/223 of query aligns to 2:212/240 of 1qhfA
4qihA The structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c complexes with vo3 (see paper)
32% identity, 83% coverage: 4:187/223 of query aligns to 3:185/209 of 4qihA
P9WIC9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
34% identity, 55% coverage: 2:123/223 of query aligns to 4:125/249 of P9WIC9
Q3JWH7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase; BPG-dependent PGAM; PGAM; Phosphoglyceromutase; dPGM; EC 5.4.2.11 from Burkholderia pseudomallei (strain 1710b) (see paper)
28% identity, 80% coverage: 4:181/223 of query aligns to 3:213/249 of Q3JWH7
3gp5A Crystal structure of phosphoglyceromutase from burkholderia pseudomallei with 3-phosphoglyceric acid and vanadate (see paper)
28% identity, 80% coverage: 4:181/223 of query aligns to 3:213/248 of 3gp5A
3fdzA Crystal structure of phosphoglyceromutase from burkholderia pseudomallei 1710b with bound 2,3-diphosphoglyceric acid and 3- phosphoglyceric acid (see paper)
28% identity, 80% coverage: 4:181/223 of query aligns to 3:213/230 of 3fdzA
>BPHYT_RS16630 FitnessBrowser__BFirm:BPHYT_RS16630
MTTQILFIRHGETDWNRIKRIQGHIDIPLATTGLAQAQRLARRMADEAKQGARLDAIYSS
DLQRAQQTAQPIADALALPLQLREGLRERSYGAFQGHDSDEIALRFPDEYAHWQTRDAGF
APPEGESLRTLYHRVLHAIEPLVAAHPGGRIACVAHGGVLDCVRRFACGLPLDAPRNYPL
LNTSVNAVDFDNGKATIVSWADVSHLDAPSADDSFKKVPEPGR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory