Comparing BPHYT_RS16700 FitnessBrowser__BFirm:BPHYT_RS16700 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2vhaA Debp (see paper)
69% identity, 91% coverage: 27:296/297 of query aligns to 7:276/276 of 2vhaA
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
68% identity, 91% coverage: 27:297/297 of query aligns to 8:278/278 of 2ia4B
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
67% identity, 82% coverage: 27:269/297 of query aligns to 5:247/503 of 8ovoA
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
32% identity, 80% coverage: 28:265/297 of query aligns to 6:234/243 of 5eyfB
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
31% identity, 78% coverage: 35:265/297 of query aligns to 4:225/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
30% identity, 78% coverage: 35:265/297 of query aligns to 4:223/225 of 4zv2A
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
28% identity, 80% coverage: 28:265/297 of query aligns to 3:227/229 of 6svfA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
30% identity, 81% coverage: 27:266/297 of query aligns to 2:229/229 of 5t0wA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
25% identity, 78% coverage: 35:265/297 of query aligns to 4:226/234 of 3k4uE
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
27% identity, 80% coverage: 25:263/297 of query aligns to 1:229/247 of 2yjpA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
26% identity, 78% coverage: 35:266/297 of query aligns to 1:223/224 of 4ymxA
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
27% identity, 80% coverage: 26:264/297 of query aligns to 1:229/231 of 2v25A
4z9nB Abc transporter / periplasmic binding protein from brucella ovis with glutathione bound
28% identity, 75% coverage: 21:244/297 of query aligns to 1:224/324 of 4z9nB
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
26% identity, 88% coverage: 27:286/297 of query aligns to 6:244/251 of 1xt8B
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
28% identity, 77% coverage: 37:265/297 of query aligns to 3:220/231 of 2q2cA
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
28% identity, 77% coverage: 37:265/297 of query aligns to 7:224/235 of 2pvuA
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
28% identity, 77% coverage: 37:265/297 of query aligns to 13:230/241 of 2q2aA
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
24% identity, 88% coverage: 11:271/297 of query aligns to 29:281/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
24% identity, 88% coverage: 11:271/297 of query aligns to 29:281/287 of 6h1uA
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
24% identity, 88% coverage: 11:271/297 of query aligns to 30:282/288 of 6h2tA
>BPHYT_RS16700 FitnessBrowser__BFirm:BPHYT_RS16700
MKVKKAALLLATLGLFTVGAHAQDAGTLKKIKDTGVISLGHRESSIPFSYYDDKQNVIGY
SQEFALKVVEAVKQKLNMPNLKVKLTPVTSQNRIPLVQNGTVDMECGSTTNNAERQQQAA
FSNTIFVIGTRLMTKKDSGIKDWADLKGKTVVTTAGTTSERLLRKMNQDKSMGMNIISAK
DHGESFLTLSTGRAAAFMMDDALLAGERAKSNNPGDFVIVGAPQSHEAYGCMIRKNDPEF
KKVVDDAIAKVETSGEADAIYKKWFESPIPPKGLNLNFPESDDIKALYKSPNDKAID
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory