Comparing BPHYT_RS16735 BPHYT_RS16735 phosphogluconate dehydratase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
6ovtA Crystal structure of ilvd from mycobacterium tuberculosis (see paper)
31% identity, 79% coverage: 68:568/634 of query aligns to 36:529/562 of 6ovtA
P9WKJ5 Dihydroxy-acid dehydratase; DAD; EC 4.2.1.9 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 79% coverage: 68:568/634 of query aligns to 49:542/575 of P9WKJ5
8hs0A The mutant structure of dhad v178w
30% identity, 86% coverage: 26:568/634 of query aligns to 18:536/570 of 8hs0A
Q9LIR4 Dihydroxy-acid dehydratase, chloroplastic; AthDHAD; DAD; EC 4.2.1.9 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 86% coverage: 26:568/634 of query aligns to 56:574/608 of Q9LIR4
Q1JUQ1 L-arabonate dehydratase; L-arabinonate dehydratase; EC 4.2.1.25 from Azospirillum brasilense (see paper)
30% identity, 80% coverage: 68:573/634 of query aligns to 41:539/583 of Q1JUQ1
8epzA Crystal structure of fe-s cluster-dependent dehydratase from paralcaligenes ureilyticus in complex with mn
29% identity, 79% coverage: 69:571/634 of query aligns to 37:524/569 of 8epzA
8ej0A Crystal structure of fe-s cluster-dependent dehydratase from paralcaligenes ureilyticus in complex with mg
29% identity, 79% coverage: 69:571/634 of query aligns to 36:523/568 of 8ej0A
B5ZZ34 L-arabinonate dehydratase; ArDHT; D-fuconate dehydratase; Galactonate dehydratase; L-arabonate dehydratase; EC 4.2.1.25; EC 4.2.1.67; EC 4.2.1.6 from Rhizobium leguminosarum bv. trifolii (strain WSM2304) (see 2 papers)
28% identity, 79% coverage: 69:568/634 of query aligns to 45:531/579 of B5ZZ34
5j85A Ser480ala mutant of l-arabinonate dehydratase (see paper)
28% identity, 79% coverage: 69:568/634 of query aligns to 42:528/576 of 5j85A
7m3kA Crystal structure of galactonate dehydratase from brucella melitensis biovar abortus 2308
28% identity, 80% coverage: 65:572/634 of query aligns to 35:539/587 of 7m3kA
5oynA Crystal structure of d-xylonate dehydratase in holo-form (see paper)
28% identity, 66% coverage: 148:568/634 of query aligns to 117:539/589 of 5oynA
Sites not aligning to the query:
Q9A9Z2 D-xylonate dehydratase; XyDHT; Gluconate dehydratase; EC 4.2.1.82; EC 4.2.1.39 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see 2 papers)
28% identity, 66% coverage: 148:568/634 of query aligns to 123:545/595 of Q9A9Z2
Sites not aligning to the query:
>BPHYT_RS16735 BPHYT_RS16735 phosphogluconate dehydratase
MVSPHSQLLKVTQRVVERSKPTREAYLARIHQAQGKFPARGALSCANLAHGFAGLEGNDK
LVIKQIREPNIGIVSSYNEMLSAHAPYKNYPDIIKQAARENGGVAQFAGGVPAMCDGVTQ
GNAGMELSLFSREVIAMSTAVALTHNMFDAALCLGICDKIVPGLLIGALQFGHIPTIFVP
AGPMGSGLSNDDKAKTRQLFATGQCDRGALLEAEAAAYHSHGTCTFYGTANSNQMLMEVM
GLHLPSSAFVHPHTPLRDALTAQAARRVLELTVERGNYTPIGHVVDEKAIVNGIVALLAT
GGSTNHTLHLVAIARAAGIVIDWDDFDTLSQAVPLLAKIYPNGKADVNHFHAAGGVAFLV
RNLLEGGLLHEDVNTVAGKGLKHYTEEPKLIDGKLQWVPGAQASEDTAVLRGIKEPFQPD
GGLRLMQGKLGRGVIKISAVAAQHRKVKAPAIVFDSQEAVQEAFDKGELKRDFIAVVRFQ
GARANGMPELHRLTPLLGVLQDQGFHVALVTDGRMSGASGKVPAVIHLSPEALLQGPIGK
VRTGDMLVIDAEAGVLDIEIDAAEWAARPNAVPQHQAENEVGFGRELFSVFRAAAAPAEQ
GASVFGAMVGERSAHHGEAAKAHTAKHTSTTHAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory