Comparing BPHYT_RS16770 FitnessBrowser__BFirm:BPHYT_RS16770 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
7wxiA Gpr domain of drosophila p5cs filament with glutamate and atpgammas (see paper)
37% identity, 97% coverage: 10:418/423 of query aligns to 5:407/430 of 7wxiA
7wxgA Gpr domain closed form of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
37% identity, 97% coverage: 10:418/423 of query aligns to 5:407/430 of 7wxgA
4jbeB 1.95 angstrom crystal structure of gamma-glutamyl phosphate reductase from saccharomonospora viridis.
31% identity, 98% coverage: 2:416/423 of query aligns to 3:408/412 of 4jbeB
5j7iB Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
25% identity, 70% coverage: 109:404/423 of query aligns to 102:426/456 of 5j7iB
5j7iC Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
25% identity, 70% coverage: 109:404/423 of query aligns to 101:425/455 of 5j7iC
5tjrD X-ray crystal structure of a methylmalonate semialdehyde dehydrogenase from pseudomonas sp. Aac (see paper)
27% identity, 95% coverage: 15:414/423 of query aligns to 38:451/468 of 5tjrD
3rhhD Crystal structure of NADP-dependent glyceraldehyde-3-phosphate dehydrogenase from bacillus halodurans c-125 complexed with NADP
25% identity, 65% coverage: 114:389/423 of query aligns to 142:456/480 of 3rhhD
6dbbA Crystal structure of a putative aldehyde dehydrogenase family protein burkholderia cenocepacia j2315 in complex with partially reduced nadh
26% identity, 75% coverage: 76:391/423 of query aligns to 92:467/504 of 6dbbA
Sites not aligning to the query:
>BPHYT_RS16770 FitnessBrowser__BFirm:BPHYT_RS16770
MDIDQYMTDLGRRARQASRAMARASTAAKNAALAAVAQGIERDAALLKEANARDVARARE
KGHDAAFIDRLTLSDKALKTMVEGLRQVAALADPIGEISNLKYRPSGIQVGQMRVPLGVI
GIIYESRPNVTIDAAALCLKSGNATILRGGSEALECNAALAKLIGEGLEKAGLPQEAVQV
VATSDRAAVGKLITMTEYVDVIVPRGGKSLIERLMNEARVPMIKHLDGICHVYVDDRADL
AKALTVCDNAKTHRYGTCNTMETLLVARGIAAEVLPPLGKLYRDKQVELRVDAAARAVLA
DAGVGPLVDATEEDWRTEYLAPVLAIKVVENLDAAIDHINTYSSQHTDAIVTEDHDRAMR
FLREVDSASVMVNASTRFADGFEFGLGAEIGISNDKLHARGPVGLEGLTSLKYVVLGHGE
GRQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory