SitesBLAST
Comparing BPHYT_RS16825 FitnessBrowser__BFirm:BPHYT_RS16825 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
29% identity, 90% coverage: 11:409/441 of query aligns to 10:420/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ R187), G195 (≠ F191), R282 (= R278)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ A267), S272 (= S268), S273 (= S269), M307 (≠ L302), T310 (≠ F305), G353 (= G348), A354 (≠ S349), R394 (= R383), T395 (≠ A384)
Sites not aligning to the query:
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
29% identity, 90% coverage: 11:409/441 of query aligns to 11:421/425 of 6zgbA
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
29% identity, 90% coverage: 11:409/441 of query aligns to 13:423/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
29% identity, 90% coverage: 11:409/441 of query aligns to 13:423/427 of 5e9sA
- binding aspartic acid: R274 (≠ A267), S275 (= S268), S276 (= S269), T313 (≠ F305), G353 (= G345), V354 (≠ I346), A357 (≠ S349), G358 (≠ A350), D394 (≠ G380), R397 (= R383), T398 (≠ A384)
- binding decyl-beta-d-maltopyranoside: L194 (≠ R187), G198 (≠ F191), Y202 (≠ L195)
- binding sodium ion: Y87 (≠ F80), T90 (≠ M83), S91 (≠ T84), S276 (= S269), G305 (= G297), A306 (≠ Y298), T307 (≠ S299), N309 (= N301), N309 (= N301), M310 (≠ L302), D311 (= D303), S348 (= S340), I349 (≠ K341), G350 (= G342), T351 (≠ A343), N401 (= N387), V402 (≠ L388), D405 (≠ N391)
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
30% identity, 90% coverage: 11:409/441 of query aligns to 6:412/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ A267), S265 (= S269), M299 (≠ L302), T302 (≠ F305), T340 (≠ A343), G342 (= G345), V343 (≠ I346), G347 (≠ A350), D383 (≠ G380), R386 (= R383), T387 (≠ A384), N390 (= N387)
- binding decyl-beta-d-maltopyranoside: H23 (= H28), V212 (≠ L216), A216 (≠ G220)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
26% identity, 90% coverage: 11:407/441 of query aligns to 15:421/425 of O59010
- S65 (≠ V55) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ A267) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ ASS 267:269) binding
- M311 (≠ L302) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ F305) binding
- V355 (≠ I346) binding
- D394 (≠ G380) binding
- M395 (≠ I381) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R383) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N387) binding
- D405 (≠ N391) mutation to N: Strongly decreased affinity for aspartate.
2nwwA Crystal structure of gltph in complex with tboa (see paper)
27% identity, 89% coverage: 11:402/441 of query aligns to 6:407/407 of 2nwwA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
26% identity, 90% coverage: 11:405/441 of query aligns to 15:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L36), F46 (≠ L36), P75 (≠ D65), L91 (≠ V82), F95 (≠ I86), L130 (= L126), I133 (≠ F132), I159 (≠ V158), Y167 (≠ L166), K196 (≠ R187), G200 (≠ F191), I207 (≠ L198), F210 (≠ L201), L250 (≠ V241), I262 (= I253), M269 (≠ L260), T334 (≠ S325), V335 (= V326), G336 (≠ H327), T340 (≠ V331), L343 (= L334), M399 (≠ L385)
- binding aspartic acid: S277 (= S268), S278 (= S269), T314 (≠ F305), G354 (= G345), A358 (≠ S349), G359 (≠ A350), D394 (≠ G380), R397 (= R383), T398 (≠ A384)
- binding sodium ion: Y89 (≠ F80), T92 (≠ M83), S93 (≠ T84), G306 (= G297), T308 (≠ S299), N310 (= N301), N310 (= N301), M311 (≠ L302), D312 (= D303), S349 (= S340), I350 (≠ K341), T352 (≠ A343), N401 (= N387), V402 (≠ L388), D405 (≠ N391)
Sites not aligning to the query:
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
26% identity, 89% coverage: 11:402/441 of query aligns to 12:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G59), V83 (= V77), I157 (≠ L159), Y164 (≠ L166), K193 (≠ R187), T305 (≠ S299), I306 (≠ F300), I347 (≠ K341)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ V12), M199 (≠ I193), S275 (= S269), T311 (≠ F305), G356 (≠ A350), L384 (= L373), D391 (≠ G380), R394 (= R383)
Sites not aligning to the query:
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
26% identity, 89% coverage: 11:403/441 of query aligns to 7:409/409 of 6bavA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
26% identity, 89% coverage: 11:402/441 of query aligns to 7:408/408 of 6bauA
- binding cysteine: S270 (= S269), M303 (≠ L302), T306 (≠ F305), A345 (≠ H344), G346 (= G345), V347 (≠ I346), G351 (≠ A350), D386 (≠ G380), C389 (≠ R383), T390 (≠ A384), N393 (= N387)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
25% identity, 89% coverage: 11:402/441 of query aligns to 7:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
28% identity, 89% coverage: 19:411/441 of query aligns to 33:412/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ V69), G89 (= G70), G92 (= G73), A95 (= A76), V96 (= V77), Y99 (≠ F80), M163 (≠ V158), F167 (≠ S162), F293 (≠ L292), V297 (≠ T296)
- binding aspartic acid: S268 (= S268), S269 (= S269), T306 (≠ F305), G346 (= G345), I347 (= I346), A350 (≠ S349), G351 (≠ A350), D380 (≠ G380), R383 (= R383), T384 (≠ A384)
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
27% identity, 89% coverage: 19:410/441 of query aligns to 25:397/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ M60), S80 (≠ V69), G81 (= G70), G84 (= G73), Y91 (≠ F80), M156 (≠ V158), F160 (≠ S162), F286 (≠ L292), V290 (≠ T296)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V52), I148 (= I150), S262 (= S269), S263 (≠ D270), A292 (≠ Y298), T293 (≠ S299), M296 (≠ L302), T299 (≠ F305), G329 (= G342), A336 (≠ S349), G337 (≠ A350), D366 (≠ G380), R369 (= R383), N373 (= N387)
P43003 Excitatory amino acid transporter 1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Homo sapiens (Human) (see 3 papers)
25% identity, 94% coverage: 4:417/441 of query aligns to 46:506/542 of P43003
- S363 (≠ A267) mutation to R: Loss of electrogenic glutamate transport. Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with M-477.
- SSS 363:365 (≠ ASS 267:269) binding
- T396 (≠ S299) binding
- T402 (≠ F305) binding
- IPQAG 443:447 (≠ IPGSA 346:350) binding
- D476 (≠ G380) binding
- R477 (≠ I381) mutation to M: Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with R-363.
- N483 (= N387) binding
Sites not aligning to the query:
- 523 Y→F: No effect on activity.
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
25% identity, 94% coverage: 4:417/441 of query aligns to 46:506/543 of P56564
- N206 (≠ D139) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N216 (≠ A144) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P43007 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Homo sapiens (Human) (see 4 papers)
26% identity, 90% coverage: 37:431/441 of query aligns to 79:508/532 of P43007
- N201 (≠ T140) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (≠ F145) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- E256 (≠ Q183) to K: in SPATCCM; does not affect localization at the cell surface; decreased uptake of L-serine and L-alanine; Vmax is decreased by at least 50% for both substrates; 3-fold increase of affinity for L-serine; 2-fold increase of affinity for L-alanine; dbSNP:rs201278558
- R457 (≠ I381) to W: in SPATCCM; does not affect localization at the cell surface; loss of uptake of L-serine and L-alanine; dbSNP:rs761533681
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
25% identity, 90% coverage: 17:411/441 of query aligns to 15:425/425 of 7xr4A
O35874 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Mus musculus (Mouse) (see 2 papers)
26% identity, 98% coverage: 7:439/441 of query aligns to 37:523/532 of O35874
- N201 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
27% identity, 80% coverage: 37:391/441 of query aligns to 39:388/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (≠ V55), L58 (≠ V56), L65 (≠ A63), V339 (≠ K341), G340 (= G342), S343 (≠ G345), I344 (= I346)
- binding cholesterol: W188 (≠ K194), I227 (≠ Y227), F250 (= F250), W257 (≠ L260), M379 (≠ A382), S382 (≠ L385)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (= S269), M300 (≠ L302), T303 (≠ F305), Y306 (= Y308), G348 (≠ A350), L349 (≠ I351), M352 (≠ L354), I366 (≠ L369), L369 (≠ I372), V370 (≠ L373), D373 (= D376), D377 (≠ G380), R380 (= R383), T381 (≠ A384), N384 (= N387)
Sites not aligning to the query:
Query Sequence
>BPHYT_RS16825 FitnessBrowser__BFirm:BPHYT_RS16825
MLKFFNSLFGRVVIALVAGIVVGAVFPHFAQSLRPLGDGFLKLIKMVIGPIVFCVVVSGM
AHAGDLRKVGRVGLKAVIYFEVMTTIALVIGAILAYVTRPGVGMNIDLHSLDPASLSTYT
EHAKSLKDTAGFLLKIIPDTAINAFATGDILQILVFSVLFGSALSLLGNKAQRVSSLIDE
LSQVFFRVMGFIIKLAPLGVLGAIAFTTGTYGVESLKQLGMLVLVFYLSCFVFVVVVLGV
VMRLAGFSIFKLIRYLREELSIVLGTASSDAVLPQIMRKLEWMGVKDSTVGLVIPTGYSF
NLDGFSIYLTLAVIFIAQATNTPLSVHDLIVVVLVSLVTSKGAHGIPGSAIVILAATLSA
IPAIPVLGLVLILPVDWFVGIARALTNLIGNCVATVVVAVWENDIDRARAHRVLNRDEAL
RYVPAGEDAEPAAAGEHAPAV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory