SitesBLAST
Comparing BPHYT_RS16880 FitnessBrowser__BFirm:BPHYT_RS16880 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P76558 NADP-dependent malic enzyme; NADP-ME; EC 1.1.1.40 from Escherichia coli (strain K12) (see paper)
61% identity, 97% coverage: 20:774/779 of query aligns to 1:753/759 of P76558
- K56 (≠ N75) modified: N6-acetyllysine
6zngF Maeb full-length acetyl-coa bound state (see paper)
45% identity, 97% coverage: 22:779/779 of query aligns to 2:753/753 of 6zngF
- active site: Y38 (= Y58), A74 (= A94), K93 (= K113), E135 (= E155), D136 (= D156), D160 (= D180), D161 (= D181), N286 (= N306)
- binding acetyl coenzyme *a: R511 (≠ M539), K514 (= K542), Y552 (≠ T581), A553 (≠ H582), R557 (≠ H586), L560 (≠ D589), P571 (≠ Y601), T590 (≠ H620), V591 (= V621), N592 (= N622), L593 (≠ V623), Y625 (≠ H655), Q659 (≠ H690), L690 (≠ I721), N694 (= N725), Q724 (≠ T756)
6zn4A Maeb malic enzyme domain apoprotein (see paper)
55% identity, 52% coverage: 22:426/779 of query aligns to 1:405/406 of 6zn4A
6zn7A Maeb malic enzyme domain apoprotein (see paper)
55% identity, 52% coverage: 22:426/779 of query aligns to 1:405/405 of 6zn7A
- active site: Y37 (= Y58), A73 (= A94), K92 (= K113), E134 (= E155), D135 (= D156), D159 (= D180), D160 (= D181), N285 (= N306)
- binding magnesium ion: E134 (= E155), D135 (= D156), D160 (= D181)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: T164 (= T185), N191 (≠ S212), A193 (= A214), G194 (= G215), A195 (= A216), S196 (≠ A217), D218 (= D239), S219 (≠ L240), K235 (= K256), L260 (= L281), S261 (= S282), V262 (≠ A283), M283 (≠ L304), N285 (= N306), V315 (= V336)
5ceeA Malic enzyme from candidatus phytoplasma aywb in complex with NAD and mg2+ (see paper)
45% identity, 51% coverage: 24:423/779 of query aligns to 1:385/387 of 5ceeA
- active site: Y34 (= Y58), A70 (= A94), K89 (= K113), E131 (= E155), D132 (= D156), D156 (= D180), D157 (= D181), N283 (= N306)
- binding magnesium ion: E131 (= E155), D132 (= D156), D157 (= D181)
- binding nicotinamide-adenine-dinucleotide: T161 (= T185), N188 (≠ S212), G189 (= G213), G191 (= G215), A193 (= A217), D213 (= D239), K214 (≠ L240), V258 (≠ L281), S259 (= S282), I263 (≠ V286), L281 (= L304), N283 (= N306), V312 (= V336), N314 (= N338)
2dvmA NAD complex structure of ph1275 protein from pyrococcus horikoshii
42% identity, 56% coverage: 24:457/779 of query aligns to 1:429/438 of 2dvmA
- active site: Y37 (= Y58), R73 (≠ A94), K92 (= K113), E134 (= E155), D135 (= D156), D159 (= D180), D160 (= D181), N296 (= N306)
- binding nicotinamide-adenine-dinucleotide: T164 (= T185), G194 (= G215), A195 (= A216), A196 (= A217), V217 (≠ T238), E218 (≠ D239), L219 (= L240), P224 (≠ G247), F269 (≠ L281), T270 (≠ S282), L294 (= L304), N296 (= N306), N327 (= N338)
2a9fA Crystal structure of a putative malic enzyme ((s)-malate:nad+ oxidoreductase (decarboxylating))
49% identity, 43% coverage: 38:372/779 of query aligns to 18:350/383 of 2a9fA
2haeD Crystal structure of a putative malic enzyme (malate oxidoreductase)
44% identity, 50% coverage: 28:418/779 of query aligns to 2:373/373 of 2haeD
2haeB Crystal structure of a putative malic enzyme (malate oxidoreductase)
44% identity, 50% coverage: 28:418/779 of query aligns to 2:373/373 of 2haeB
- active site: Y31 (= Y58), A67 (= A94), K86 (= K113), E128 (= E155), D129 (= D156), D153 (= D180), D154 (= D181), N280 (= N306)
- binding nicotinamide-adenine-dinucleotide: T158 (= T185), N185 (≠ S212), G188 (= G215), A189 (= A216), A190 (= A217), D210 (= D239), R211 (≠ L240), V255 (≠ L281), S256 (= S282), R257 (≠ A283), L278 (= L304), A279 (= A305), N280 (= N306), N311 (= N338)
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
32% identity, 41% coverage: 453:770/779 of query aligns to 393:704/714 of Q8ZND6
Sites not aligning to the query:
- 252 R→H: Increases speed of forward and back reactions by 2-3 fold. Not inhibited by NADH.
- 273 G→D: Increases speed of forward and back reactions by 2-3 fold.
- 294 M→I: Slightly decreases speed of forward and back reactions.
1xcoD Crystal structure of a phosphotransacetylase from bacillus subtilis in complex with acetylphosphate (see paper)
31% identity, 40% coverage: 465:776/779 of query aligns to 20:325/325 of 1xcoD
6ioxA Crystal structure of porphyromonas gingivalis phosphotransacetylase in complex with acetyl-coa (see paper)
29% identity, 42% coverage: 452:779/779 of query aligns to 8:338/339 of 6ioxA
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
24% identity, 39% coverage: 464:770/779 of query aligns to 16:322/332 of 2af3C
- binding coenzyme a: R86 (≠ M539), S127 (≠ T581), L131 (= L585), V135 (≠ D589), L146 (≠ V600), A147 (≠ Y601), G172 (≠ H620), M173 (≠ V621), M173 (≠ V621), V174 (≠ N622), E175 (≠ V623), N278 (= N725), Y281 (= Y728), K282 (≠ N729), Q285 (≠ K732), G294 (= G742), P295 (= P743), T297 (≠ L745), D306 (≠ V754), L307 (= L755), S308 (≠ T756)
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
24% identity, 39% coverage: 464:770/779 of query aligns to 17:323/333 of P38503
- C159 (≠ R612) mutation to A: Loss of activity.; mutation to S: No loss of activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
P16243 NADP-dependent malic enzyme, chloroplastic; NADP-ME; EC 1.1.1.40 from Zea mays (Maize) (see 3 papers)
26% identity, 49% coverage: 54:437/779 of query aligns to 180:625/636 of P16243
- R237 (≠ A94) mutation to L: Decreases kcat 530-fold. Increases Km for NADP 36-fold and Km for malate 10-fold.
- K255 (= K113) mutation to I: Increases Km for malate 10-fold, and Km for NADP 15-fold. Decreases kcat 200-fold.
- E339 (= E166) mutation to A: No effect on kcat and Km for NADP. Increases Km for malate 2-fold.
- A387 (= A217) mutation to G: Decreases kcat 48-fold. Increases Km for NADP 4-fold. Increases Km for malate 6-fold.
- A392 (vs. gap) mutation to G: No effect on kcat. Increases Km for NADP 3.5-fold. Increases Km for malate 2.5-fold.
- KK 435:436 (≠ KE 256:257) mutation to LL: No effect on kcat and on Km for malate. Increases Km for NADP 9-fold.
- Q503 (≠ L315) mutation to E: No effect on kcat and Km for NADP. Increases Km for malate 2-fold.
- L544 (= L345) mutation to F: No effect on kcat and Km for NADP. Increases Km for malate 2-fold.
Sites not aligning to the query:
- 140 F→I: Decreases kcat 8-fold. Decreases Km for NADP 2-fold, increases Km for malate 2-fold.
7x11A Crystal structure of me1 in complex with NADPH (see paper)
27% identity, 36% coverage: 88:371/779 of query aligns to 144:482/564 of 7x11A
- binding 6-[(7-methyl-2-propyl-imidazo[4,5-b]pyridin-4-yl)methyl]-2-[2-(1H-1,2,3,4-tetrazol-5-yl)phenyl]-1,3-benzothiazole: N244 (≠ A159), F248 (= F163), I265 (≠ Q182), Q266 (≠ H183), L302 (= L219), G303 (≠ A220), H306 (≠ D223), E345 (≠ D255), D470 (≠ R359)
- binding manganese (ii) ion: E240 (= E155), D241 (= D156), D264 (= D181)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R150 (≠ A94), N244 (≠ A159), T268 (= T185), A297 (= A214), G298 (= G215), E299 (≠ A216), A300 (= A217), D330 (= D239), S331 (≠ L240), K332 (≠ A241), K346 (= K256), V374 (≠ L281), A375 (≠ S282), A376 (= A283), I377 (vs. gap), L401 (= L304), S402 (≠ A305), N403 (= N306), G447 (≠ V336)
1gq2A Malic enzyme from pigeon liver (see paper)
27% identity, 45% coverage: 88:434/779 of query aligns to 137:527/555 of 1gq2A
- active site: R143 (≠ A94), K161 (= K113), E233 (= E155), D234 (= D156), D256 (= D180), D257 (= D181), N396 (= N306)
- binding manganese (ii) ion: K161 (= K113), E233 (= E155), D234 (= D156), D257 (= D181)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R143 (≠ A94), G146 (= G97), N237 (≠ A159), T261 (= T185), G289 (= G213), A290 (= A214), G291 (= G215), E292 (≠ A216), A293 (= A217), V322 (≠ T238), D323 (= D239), S324 (≠ L240), A368 (≠ S282), I370 (vs. gap), L394 (= L304), N396 (= N306), G440 (≠ V336), N441 (= N337), N442 (= N338)
- binding oxalate ion: R143 (≠ A94), L145 (= L96), D257 (= D181), N396 (= N306), N442 (= N338)
Sites not aligning to the query:
P40927 NADP-dependent malic enzyme; NADP-ME; EC 1.1.1.40 from Columba livia (Rock dove) (see 3 papers)
27% identity, 45% coverage: 88:434/779 of query aligns to 138:528/557 of P40927
- D141 (≠ N91) mutation to N: Increases Km for manganese 14-fold. Increases Km for malate 5-fold.
- R144 (≠ A94) binding ; binding
- K162 (= K113) binding ; mutation to A: Decreases kcat 235-fold. no effect on Km for NADP.
- D194 (= D134) mutation to N: No effect on Km for manganese. Increases Km for malate 8-fold.
- E234 (= E155) binding
- D235 (= D156) binding
- N238 (≠ A159) binding
- D258 (= D181) binding
- AGEA 291:294 (≠ AGAA 214:217) binding
- S325 (≠ L240) binding
- K340 (= K256) mutation to A: Increases Km for NADP 65-fold. No effect on kcat.
- N397 (= N306) binding
- N443 (= N338) binding ; binding
- D464 (≠ R359) mutation to N: No effect.
6w49A Trypanosoma cruzi malic enzyme in complex with inhibitor (mec010) (see paper)
25% identity, 41% coverage: 54:369/779 of query aligns to 82:475/543 of 6w49A
6w29A Trypanosoma cruzi malic enzyme in complex with inhibitor (mec013) (see paper)
25% identity, 41% coverage: 54:369/779 of query aligns to 84:477/545 of 6w29A
Query Sequence
>BPHYT_RS16880 FitnessBrowser__BFirm:BPHYT_RS16880
MPSNVYSNPPSEARLMSTPVNSKLREAALDYHEFPTPGKIAIAPTKQMINQRDLALAYSP
GVAFACEEIVENPLNAARFTARSNLVGVVTNGTAVLGLGNIGPLASKPVMEGKAVLFKKF
AGIDVFDIELNESDPHKLVDVIAALEPTFGGINLEDIKAPDCFIVERECRKRMKIPVFHD
DQHGTAIVVAAAITNGLKVVGKDIKEVKLVSSGAGAAALACLDLLVDIGLPLENITVTDL
AGVVYKGRVELMDPDKERFARETDARTLAEAIGGADVFLGLSAGGVLKQDMVKQMADKPL
ILALANPTPEILPELALEVRPDAVLCTGRTDYPNQVNNVLVFPFLFRGALDAGATTVTRE
MEIAAVNAIAELARQEQSDIVATAYGIQDLSFGPEYLIPKPFDPRLIVKVAPAVAKAAMD
SGVAERPIEDMEAYEQHLQQFVYHSGTTMKPIFQLARGVEPEKKRIVFAEGEEERVLRAM
QIIVDEKLAKPILIGRPAVIEQRIARYGLRLIAGQDYTVVNTDHDERYRDFWQEYHKMMS
RKGISAQMAKLEMRRRTTLIGAMLVEKGEADGMICGTVSTTHRHLHFIDQVIGKKEGAKV
YAAMNALVLPNRQIFLVDTHVNVDPTPEQLAEITIMAAEEVRRFGIEPKIALLSHSNFGT
SNAPTAQKMRDTLAILRERAPDLQVDGEMHGDIALDANLRREVMPDSTLEGDANLLVLPN
IDAANISYNLLKTAAGNNIAIGPMLLGAAKPVHVLTASATVRRIVNMTALLVADVIAAR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory