Comparing BPHYT_RS16915 FitnessBrowser__BFirm:BPHYT_RS16915 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
7pldB Caulobacter crescentus xylonolactonase with (r)-4-hydroxy-2- pyrrolidone (see paper)
36% identity, 93% coverage: 15:292/300 of query aligns to 10:283/289 of 7pldB
7plbB Caulobacter crescentus xylonolactonase with d-xylose (see paper)
36% identity, 93% coverage: 15:292/300 of query aligns to 10:283/289 of 7plbB
Q9A9Z1 D-xylonolactone lactonase; Xylono-1,5-lactonase; EC 3.1.1.110 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see paper)
36% identity, 93% coverage: 15:292/300 of query aligns to 10:283/289 of Q9A9Z1
5gx1A Luciferin-regenerating enzyme collected with serial synchrotron rotational crystallography with accumulated dose of 1.1 mgy (1st measurement) (see paper)
33% identity, 91% coverage: 17:290/300 of query aligns to 12:300/307 of 5gx1A
5d9bA Luciferin-regenerating enzyme solved by siras using xfel (refined against native data) (see paper)
33% identity, 91% coverage: 17:290/300 of query aligns to 12:300/307 of 5d9bA
4gncA Human smp30/gnl-1,5-ag complex (see paper)
28% identity, 95% coverage: 13:297/300 of query aligns to 8:298/298 of 4gncA
Q15493 Regucalcin; RC; Gluconolactonase; GNL; Senescence marker protein 30; SMP-30; EC 3.1.1.17 from Homo sapiens (Human) (see 2 papers)
28% identity, 95% coverage: 13:297/300 of query aligns to 9:299/299 of Q15493
3g4hA Crystal structure of human senescence marker protein-30 (zinc bound) (see paper)
28% identity, 95% coverage: 13:297/300 of query aligns to 7:297/297 of 3g4hA
4gnaA Mouse smp30/gnl-xylitol complex (see paper)
30% identity, 92% coverage: 21:297/300 of query aligns to 15:297/297 of 4gnaA
4gn9A Mouse smp30/gnl-glucose complex (see paper)
30% identity, 92% coverage: 21:297/300 of query aligns to 15:297/297 of 4gn9A
4gn8A Mouse smp30/gnl-1,5-ag complex (see paper)
30% identity, 92% coverage: 21:297/300 of query aligns to 15:297/297 of 4gn8A
4gn7A Mouse smp30/gnl (see paper)
30% identity, 92% coverage: 21:297/300 of query aligns to 15:297/297 of 4gn7A
3dr2A Structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways (see paper)
28% identity, 84% coverage: 12:264/300 of query aligns to 35:292/299 of 3dr2A
>BPHYT_RS16915 FitnessBrowser__BFirm:BPHYT_RS16915
MSASGSPGTAALLLDTKCTLGEGATWCAQTGHFYWTDIEGARLWRYDPRDCSNMSWHMPE
RLATFALCADPRYLLLGLATHLAFFELATGETRRIIDVEAGLNTRVNDGRCDRQGRFVFG
TKDEGAPLQAIGGFYRLGHDLSLERLPLPAPAISNSIAFSPDGATMYYCDSPTREIRACD
YRADGSIANDRLFTRLTDATGEPDGSTVDRDGGLWNAQWGGRRVVRYGPDGMETERVDVP
TAQPSCVALGGTQLDTLYITSARCDLDAAALANDPHAGGVFIATLGRRGLPEPVFQGAPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory