Comparing BPHYT_RS17305 FitnessBrowser__BFirm:BPHYT_RS17305 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 96% coverage: 17:398/398 of query aligns to 51:427/440 of O04373
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
38% identity, 96% coverage: 8:390/398 of query aligns to 4:372/380 of P54955
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 96% coverage: 14:394/398 of query aligns to 52:427/442 of P54968
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
30% identity, 87% coverage: 2:349/398 of query aligns to 4:350/389 of 4ewtA
Sites not aligning to the query:
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
33% identity, 84% coverage: 2:337/398 of query aligns to 7:344/398 of 6slfA
Sites not aligning to the query:
3ramA Crystal structure of hmra (see paper)
27% identity, 69% coverage: 17:291/398 of query aligns to 21:274/391 of 3ramA
Sites not aligning to the query:
>BPHYT_RS17305 FitnessBrowser__BFirm:BPHYT_RS17305
MKLIPEIQAAHGEIQTLRRTIHAHPELRYEETATADLVARTLESWGIETHRGLGKTGVVG
VLKRGNGSRSIGLRADMDALPIQELNSFDHRSKNDGKMHACGHDGHTAMLLGAARHLVKH
GEFDGTIVFIFQPAEEGGAGAQAMIDDGLFVKFPVDAVFGIHNWPGMPAGQFGVTEGPIM
ASSNEFHIEIKGVGSHAALPHNGHDPVFTAVQIANGLQSIITRNKKPLDTAVLSITQIHA
GDAVNVVPNNAWIAGTVRTFTTDTLDLIEARMRKIAESTAEAYDCSVDIQFHRNYPPTIN
SSEEARFAATVMKEIVGAENVDDAVEPTMGAEDFSFMLLAKPGCYAFLGNGDGGHRDSGH
GAGPCMLHNASYDFNDELLPIGSTYWVRLAQRFLAQGK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory