SitesBLAST
Comparing BPHYT_RS17845 FitnessBrowser__BFirm:BPHYT_RS17845 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
25% identity, 71% coverage: 121:419/424 of query aligns to 79:370/377 of Q5L2C2
- V180 (= V215) binding
- R309 (= R359) binding
- 334:340 (vs. 383:389, 29% identical) binding
- R336 (≠ S385) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
25% identity, 71% coverage: 121:419/424 of query aligns to 78:368/370 of 4yshA
- active site: I262 (≠ V314), L283 (= L335), G305 (= G357), N335 (≠ T386), L338 (≠ A389)
- binding flavin-adenine dinucleotide: V178 (= V215), S206 (≠ L256), G207 (= G257), W209 (≠ D259), R307 (= R359), H332 (= H383), R334 (≠ S385), N335 (≠ T386), G336 (= G387), I337 (≠ W388)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 47, 48
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
25% identity, 71% coverage: 121:419/424 of query aligns to 78:368/368 of 4yshB
- active site: I262 (≠ V314), L283 (= L335), G305 (= G357), N335 (≠ T386), L338 (≠ A389)
- binding flavin-adenine dinucleotide: V178 (= V215), S206 (≠ L256), W209 (≠ D259), R307 (= R359), H332 (= H383), R334 (≠ S385), N335 (≠ T386), G336 (= G387), I337 (≠ W388), L338 (≠ A389)
- binding glycine: G249 (vs. gap), Y251 (vs. gap), Y251 (vs. gap), A264 (≠ G316), R307 (= R359), R334 (≠ S385), R334 (≠ S385)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 48
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
27% identity, 62% coverage: 160:420/424 of query aligns to 111:392/828 of 1pj6A
- active site: H223 (≠ K277), Y257 (vs. gap)
- binding flavin-adenine dinucleotide: V172 (= V223), A201 (≠ L256), G202 (= G257), W204 (≠ D259), H223 (≠ K277), Y257 (vs. gap), G331 (= G357), I332 (≠ R358), V358 (≠ L377), W359 (= W378), V360 (≠ L379), T361 (≠ N380)
Sites not aligning to the query:
- active site: 550
- binding flavin-adenine dinucleotide: 9, 11, 12, 13, 33, 34, 42, 43, 44, 46, 48, 50
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
27% identity, 62% coverage: 160:420/424 of query aligns to 113:394/830 of Q9AGP8
- V174 (= V223) binding
- H225 (≠ K277) Important for catalytic activity; mutation to Q: Reduces catalytic efficiency 3-fold and substrate affinity 30-fold.
- Y259 (vs. gap) Important for catalytic activity; binding ; mutation to F: Reduces catalytic efficiency 225-fold and substrate affinity 25-fold.
- VWVT 360:363 (≠ LWLN 377:380) binding
Sites not aligning to the query:
- 14:15 binding
- 35:36 binding
- 45:48 binding
- 52 binding
- 539 binding
- 552 Important for catalytic activity; D→A: No effect on the activity.; D→N: Reduces activity 3-fold.
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
27% identity, 62% coverage: 160:420/424 of query aligns to 110:391/827 of 3gsiA
- active site: H222 (≠ K277), Y256 (vs. gap)
- binding flavin-adenine dinucleotide: T170 (≠ R222), V171 (= V223), A200 (≠ L256), G201 (= G257), W203 (≠ D259), H222 (≠ K277), Y256 (vs. gap), G330 (= G357), I331 (≠ R358), F332 (≠ R359), V357 (≠ L377), W358 (= W378), V359 (≠ L379), T360 (≠ N380)
- binding magnesium ion: D254 (≠ S300)
Sites not aligning to the query:
- active site: 549
- binding flavin-adenine dinucleotide: 10, 11, 12, 32, 33, 41, 42, 43, 45, 47, 49
- binding magnesium ion: 409
- binding (6s)-5,6,7,8-tetrahydrofolate: 505, 536, 551, 563, 629, 648, 655, 696
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
27% identity, 62% coverage: 160:420/424 of query aligns to 110:391/827 of 1pj7A
- active site: H222 (≠ K277), Y256 (vs. gap)
- binding flavin-adenine dinucleotide: T170 (≠ R222), V171 (= V223), A200 (≠ L256), G201 (= G257), W203 (≠ D259), H222 (≠ K277), Y256 (vs. gap), I331 (≠ R358), V357 (≠ L377), W358 (= W378), V359 (≠ L379), T360 (≠ N380)
Sites not aligning to the query:
- active site: 549
- binding flavin-adenine dinucleotide: 8, 10, 11, 12, 32, 33, 41, 42, 43, 45, 47, 49
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: 505, 536, 549, 551, 563, 629, 648, 655, 696
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
28% identity, 41% coverage: 247:418/424 of query aligns to 193:360/364 of 3if9A
- binding flavin-adenine dinucleotide: S202 (≠ L256), G203 (= G257), W205 (≠ D259), F209 (≠ L263), G300 (= G357), R302 (= R359), H327 (= H383), F328 (≠ G384), R329 (≠ S385), N330 (≠ T386), G331 (= G387), I332 (≠ W388)
- binding glycolic acid: Y246 (≠ T303), R302 (= R359), R329 (≠ S385)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49, 173, 174
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
28% identity, 41% coverage: 247:418/424 of query aligns to 193:360/369 of O31616
- H244 (≠ L301) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (= R359) binding
- 327:333 (vs. 383:389, 29% identical) binding
- R329 (≠ S385) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
- 174 binding
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
28% identity, 41% coverage: 247:418/424 of query aligns to 193:360/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (≠ T303), R302 (= R359), R329 (≠ S385)
- binding flavin-adenine dinucleotide: S202 (≠ L256), G203 (= G257), W205 (≠ D259), F209 (≠ L263), G300 (= G357), R302 (= R359), H327 (= H383), R329 (≠ S385), N330 (≠ T386), G331 (= G387), I332 (≠ W388)
- binding phosphate ion: R254 (≠ N311)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49, 174
- binding phosphate ion: 89
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
26% identity, 56% coverage: 166:402/424 of query aligns to 120:346/369 of S5FMM4
- S202 (≠ L256) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ W388) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ V398) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- 81 K→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
6j39A Crystal structure of cmis2 with inhibitor (see paper)
26% identity, 72% coverage: 104:409/424 of query aligns to 54:359/368 of 6j39A
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: R243 (= R293), Y252 (≠ T303), Y267 (≠ A318), R308 (= R359), R334 (≠ S385), I335 (≠ T386)
- binding flavin-adenine dinucleotide: A174 (≠ D214), A203 (≠ L256), W206 (≠ D259), I228 (≠ S280), Y252 (≠ T303), R308 (= R359), S333 (≠ G384), R334 (≠ S385), I335 (≠ T386), G336 (= G387), V337 (≠ W388), Q338 (≠ A389)
Sites not aligning to the query:
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: 44, 46, 49
- binding flavin-adenine dinucleotide: 7, 9, 10, 11, 29, 30, 31, 32, 36, 37, 38, 40, 41, 42, 43, 44
6j38A Crystal structure of cmis2 (see paper)
26% identity, 72% coverage: 104:409/424 of query aligns to 54:359/368 of 6j38A
- binding flavin-adenine dinucleotide: A174 (≠ D214), A203 (≠ L256), W206 (≠ D259), G226 (= G278), G306 (= G357), R308 (= R359), S333 (≠ G384), R334 (≠ S385), I335 (≠ T386), G336 (= G387), V337 (≠ W388), Q338 (≠ A389)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 9, 11, 29, 30, 31, 36, 37, 38, 41, 42, 43, 44
4x9mA Oxidized l-alpha-glycerophosphate oxidase from mycoplasma pneumoniae with fad bound (see paper)
47% identity, 11% coverage: 4:50/424 of query aligns to 7:53/384 of 4x9mA
- binding flavin-adenine dinucleotide: G10 (= G7), G12 (= G9), I14 (= I11), E33 (= E30), K34 (≠ R31), E41 (≠ S38), T42 (= T39), S43 (= S40), A45 (≠ G42), N46 (= N43), S47 (≠ A44), V49 (= V46), H51 (≠ A48)
- binding sn-glycerol-3-phosphate: S47 (≠ A44), H51 (≠ A48)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 176, 177, 209, 210, 212, 234, 319, 320, 346, 347, 348, 349, 350, 351, 352
- binding sn-glycerol-3-phosphate: 258, 259, 320, 348
P75063 Glycerol 3-phosphate oxidase; GlpO; L-alpha-glycerophosphate oxidase; EC 1.1.3.21 from Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) (Mycoplasmoides pneumoniae) (see paper)
47% identity, 11% coverage: 4:50/424 of query aligns to 7:53/384 of P75063
Sites not aligning to the query:
- 177 binding
- 346:347 binding
- 352 binding
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
23% identity, 57% coverage: 173:414/424 of query aligns to 124:356/363 of 7cyxA
- binding flavin-adenine dinucleotide: V171 (= V223), G200 (≠ L256), G201 (= G257), W203 (≠ D259), G298 (= G357), R300 (= R359), P301 (= P360), Y326 (≠ G384), R327 (≠ S385), N328 (≠ T386), G329 (= G387), I330 (≠ W388)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 8, 10, 11, 12, 30, 31, 32, 38, 39, 40, 43, 45, 46
Query Sequence
>BPHYT_RS17845 FitnessBrowser__BFirm:BPHYT_RS17845
MKTIVLGGGVIGVATAFYLRQQGCEVTVIEREPDVALSTSFGNAGVIAPGYVTPWAAPGM
PAKILKYLFKPASPLIFRPTLDAAQWRWIARWLHECDLERFRVNKQRMQRIAYYSRDCLH
EFRARYPFDYGRSQGYLQLFRSEYDVELAQPALAVLRDAGIAHREVSAAQCVEIEPGLSW
ARQAPLSGLYLPDDEAGDCARFTRELRAICERNDVRFRFDTRVTSLDVHGGAVRAVRIES
ERGAEMLYADAVVVALGVDSAGLLARLGVKVPLYPVKGYSATLPVTDEEKAPRGALMDES
LKTAITRFGNNLRVAGTAELGNRQTTLREQALQTLMKVLNDWFPHAANPTSAHFWVGRRP
MTPDGAPLLGPSGVEKLWLNLGHGSTGWAMSMGSGRVVADLITHRKPEIDLDGLTLARYR
KSRG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory