Comparing BPHYT_RS18500 FitnessBrowser__BFirm:BPHYT_RS18500 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4bvaA Crystal structure of the NADPH-t3 form of mouse mu-crystallin. (see paper)
35% identity, 75% coverage: 78:303/303 of query aligns to 86:302/303 of 4bvaA
Sites not aligning to the query:
4bv9A Crystal structure of the NADPH form of mouse mu-crystallin. (see paper)
35% identity, 75% coverage: 78:303/303 of query aligns to 87:303/303 of 4bv9A
Sites not aligning to the query:
2i99A Crystal structure of human mu_crystallin at 2.6 angstrom (see paper)
33% identity, 75% coverage: 78:303/303 of query aligns to 95:311/312 of 2i99A
Sites not aligning to the query:
Q14894 Ketimine reductase mu-crystallin; NADP-regulated thyroid-hormone-binding protein; EC 1.5.1.25 from Homo sapiens (Human) (see paper)
33% identity, 75% coverage: 78:303/303 of query aligns to 96:312/314 of Q14894
6t3eB Structure of thermococcus litoralis delta(1)-pyrroline-2-carboxylate reductase in complex with nadh and l-proline (see paper)
27% identity, 99% coverage: 1:300/303 of query aligns to 1:313/325 of 6t3eB
1omoA Alanine dehydrogenase dimer w/bound NAD (archaeal) (see paper)
28% identity, 98% coverage: 3:300/303 of query aligns to 5:307/320 of 1omoA
O28608 Alanine dehydrogenase; AlaDH; EC 1.4.1.1 from Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) (see paper)
28% identity, 98% coverage: 3:300/303 of query aligns to 5:307/322 of O28608
6rqaB Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
26% identity, 98% coverage: 1:297/303 of query aligns to 3:307/322 of 6rqaB
6rqaA Crystal structure of the iminosuccinate reductase of paracoccus denitrificans in complex with NAD+ (see paper)
26% identity, 98% coverage: 1:297/303 of query aligns to 3:307/322 of 6rqaA
A1B8Z0 Iminosuccinate reductase; EC 1.4.1.- from Paracoccus denitrificans (strain Pd 1222) (see paper)
26% identity, 98% coverage: 1:297/303 of query aligns to 1:305/320 of A1B8Z0
Q9FLY0 Protein SAR DEFICIENT 4; Ornithine cyclodeaminase-like protein; AtOCD from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 73% coverage: 80:299/303 of query aligns to 93:319/325 of Q9FLY0
Sites not aligning to the query:
4mp6A Staphyloferrin b precursor biosynthetic enzyme sbnb bound to citrate and NAD+ (see paper)
21% identity, 74% coverage: 77:300/303 of query aligns to 96:321/334 of 4mp6A
Sites not aligning to the query:
4m54A The structure of the staphyloferrin b precursor biosynthetic enzyme sbnb bound to n-(1-amino-1-carboxyl-2-ethyl)-glutamic acid and nadh (see paper)
20% identity, 74% coverage: 77:300/303 of query aligns to 91:297/310 of 4m54A
Sites not aligning to the query:
8j1cA Structure of amino acid dehydrogenase in complex with NADP (see paper)
27% identity, 81% coverage: 54:299/303 of query aligns to 57:297/300 of 8j1cA
4mpdA Staphyloferrin b precursor biosynthetic enzyme sbnb bound a- ketoglutarate and NAD+ (see paper)
21% identity, 74% coverage: 77:300/303 of query aligns to 84:305/318 of 4mpdA
Sites not aligning to the query:
8j1cB Structure of amino acid dehydrogenase in complex with NADP (see paper)
27% identity, 81% coverage: 54:299/303 of query aligns to 57:297/299 of 8j1cB
Sites not aligning to the query:
8j1gB Structure of amino acid dehydrogenase in complex with NADPH (see paper)
28% identity, 81% coverage: 54:299/303 of query aligns to 57:309/312 of 8j1gB
Sites not aligning to the query:
1x7dA Crystal structure analysis of ornithine cyclodeaminase complexed with NAD and ornithine to 1.6 angstroms (see paper)
28% identity, 64% coverage: 98:290/303 of query aligns to 108:299/340 of 1x7dA
Sites not aligning to the query:
1u7hA Structure and a proposed mechanism for ornithine cyclodeaminase from pseudomonas putida (see paper)
28% identity, 64% coverage: 98:290/303 of query aligns to 108:299/341 of 1u7hA
Sites not aligning to the query:
Q88H32 Ornithine cyclodeaminase; OCD; EC 4.3.1.12 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
28% identity, 64% coverage: 98:290/303 of query aligns to 109:300/350 of Q88H32
Sites not aligning to the query:
>BPHYT_RS18500 FitnessBrowser__BFirm:BPHYT_RS18500
MKLITDEQVRGALTLNESSSVVRDAFLADARGRAVSLQRSRKQLDNVTLSVMGGIVTDAE
VCGAKVYSTLAGKFDFVVVLFDTKDGRYLASIQGNALTEFRTAATTRVAVEAQLPENAST
LTVFGAGVQAKAHIAALLEIGVFKRVYIVSKGDGEQLASKFRASHPDVEFLTEDIQSAVS
QADVLVTCTRSPTPIFDGALLKPNVFVAAIGSSKPQTREIDDTTLERASRVIVELKEQAQ
KEAGDLLMAKEGIVDWAKVEELGPVLAASEGQERAKGITVYKSVGVGLVDVALSALVYKK
LAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory