SitesBLAST
Comparing BPHYT_RS18560 FitnessBrowser__BFirm:BPHYT_RS18560 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4amvA E.Coli glucosamine-6p synthase in complex with fructose-6p (see paper)
56% identity, 100% coverage: 2:605/605 of query aligns to 1:608/608 of 4amvA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N99), G99 (= G100), Y248 (= Y247), E481 (= E478), K485 (= K482), E488 (= E485), H504 (= H501), K603 (= K600)
- binding fructose -6-phosphate: G301 (= G297), T302 (= T298), S303 (= S299), S347 (= S343), Q348 (= Q344), S349 (= S345), T352 (= T348), S401 (= S397), K485 (= K482), E488 (= E485)
1jxaA Glucosamine 6-phosphate synthase with glucose 6-phosphate (see paper)
56% identity, 100% coverage: 2:605/605 of query aligns to 1:608/608 of 1jxaA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N99), G99 (= G100), Y248 (= Y247), E481 (= E478), K485 (= K482), E488 (= E485), H504 (= H501), K603 (= K600)
- binding glucose-6-phosphate: T302 (= T298), S303 (= S299), S347 (= S343), Q348 (= Q344), S349 (= S345), T352 (= T348), S401 (= S397), K485 (= K482), E488 (= E485)
2j6hA E. Coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo- l-norleucine (see paper)
55% identity, 100% coverage: 2:605/605 of query aligns to 1:608/608 of 2j6hA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N99), G99 (= G100), Y248 (= Y247), E481 (= E478), K485 (= K482), E488 (= E485), H504 (= H501), K603 (= K600)
- binding glucose-6-phosphate: T302 (= T298), S347 (= S343), Q348 (= Q344), S349 (= S345), T352 (= T348), V399 (= V395), S401 (= S397), E488 (= E485)
- binding 5-oxo-l-norleucine: C1 (= C2), R73 (= R73), W74 (= W74), T76 (= T76), H86 (= H86), N98 (= N99), G99 (= G100), D123 (= D124)
1mosA Isomerase domain of glucosamine 6-phosphate synthase complexed with 2- amino-2-deoxyglucitol 6-phosphate (see paper)
57% identity, 60% coverage: 245:605/605 of query aligns to 5:367/367 of 1mosA
- active site: E240 (= E478), K244 (= K482), E247 (= E485), H263 (= H501), K362 (= K600)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T61 (= T298), S62 (= S299), S106 (= S343), Q107 (= Q344), S108 (= S345), T111 (= T348), K244 (= K482), E247 (= E485)
1morA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucose 6-phosphate (see paper)
57% identity, 60% coverage: 245:605/605 of query aligns to 4:366/366 of 1morA
- active site: E239 (= E478), K243 (= K482), E246 (= E485), H262 (= H501), K361 (= K600)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (= T298), S105 (= S343), Q106 (= Q344), S107 (= S345), T110 (= T348), V157 (= V395), A360 (= A599), K361 (= K600)
1moqA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucosamine 6-phosphate (see paper)
57% identity, 60% coverage: 245:605/605 of query aligns to 4:366/366 of 1moqA
- active site: E239 (= E478), K243 (= K482), E246 (= E485), H262 (= H501), K361 (= K600)
- binding 2-amino-2-deoxy-6-O-phosphono-alpha-D-glucopyranose: T60 (= T298), S61 (= S299), S105 (= S343), Q106 (= Q344), S107 (= S345), T110 (= T348), V157 (= V395), A360 (= A599), K361 (= K600)
7dnrA Crystal structure of zn-bound sis domain of glucosamine-6-p synthase from e. Coli
56% identity, 58% coverage: 245:596/605 of query aligns to 4:357/357 of 7dnrA
6svmA Crystal structure of human gfat-1 in complex with glucose-6-phosphate, l-glu, and udp-galnac (see paper)
38% identity, 100% coverage: 2:605/605 of query aligns to 1:660/660 of 6svmA
- active site: L7 (≠ V8), R32 (= R27), W95 (= W74), N122 (= N99), G123 (= G100), E533 (= E478), K537 (= K482), E540 (= E485), H556 (= H501), K655 (= K600)
- binding glucose-6-phosphate: C353 (= C296), T355 (= T298), S356 (= S299), S400 (= S343), Q401 (= Q344), S402 (= S345), T405 (= T348), S453 (= S397), K537 (= K482), E540 (= E485)
- binding glutamic acid: C1 (= C2), R94 (= R73), W95 (= W74), T97 (= T76), H107 (= H86), G123 (= G100), D147 (= D124)
- binding magnesium ion: S434 (≠ V378), R435 (= R379), T437 (= T381)
- binding uridine-diphosphate-n-acetylgalactosamine: Q289 (= Q229), R322 (≠ A269), G334 (≠ A281), G424 (≠ A368), T426 (≠ C370), S434 (≠ V378), T437 (= T381), C439 (≠ F383), G440 (≠ S384), V441 (≠ F385), H442 (≠ L386)
6r4eA Crystal structure of human gfat-1 in complex with glucose-6-phosphate and l-glu (see paper)
38% identity, 100% coverage: 2:605/605 of query aligns to 1:663/663 of 6r4eA
- active site: L7 (≠ V8), R32 (= R27), W95 (= W74), N122 (= N99), G123 (= G100), E536 (= E478), K540 (= K482), E543 (= E485), H559 (= H501), K658 (= K600)
- binding glucose-6-phosphate: T358 (= T298), S359 (= S299), S403 (= S343), Q404 (= Q344), S405 (= S345), T408 (= T348), S456 (= S397), K540 (= K482), E543 (= E485)
- binding glutamic acid: C1 (= C2), R94 (= R73), W95 (= W74), T97 (= T76), G123 (= G100), D147 (= D124)
6r4gA Crystal structure of human gfat-1 in complex with udp-glcnac (see paper)
37% identity, 99% coverage: 2:598/605 of query aligns to 1:652/652 of 6r4gA
- active site: L7 (≠ V8), R32 (= R27), W95 (= W74), N122 (= N99), G123 (= G100), E532 (= E478), K536 (= K482), E539 (= E485), H555 (= H501)
- binding glucose-6-phosphate: G353 (= G297), T354 (= T298), S355 (= S299), S399 (= S343), Q400 (= Q344), S401 (= S345), T404 (= T348), S452 (= S397), E539 (= E485)
- binding magnesium ion: S433 (≠ V378), R434 (= R379), T436 (= T381)
- binding uridine-diphosphate-n-acetylglucosamine: Q288 (= Q229), R321 (≠ A269), G333 (≠ A281), G423 (≠ A368), T425 (≠ C370), S433 (≠ V378), T436 (= T381), C438 (≠ F383), G439 (≠ S384), V440 (≠ F385), H441 (≠ L386)
Q06210 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1; D-fructose-6-phosphate amidotransferase 1; Glutamine:fructose-6-phosphate amidotransferase 1; GFAT 1; GFAT1; Hexosephosphate aminotransferase 1; EC 2.6.1.16 from Homo sapiens (Human) (see paper)
40% identity, 70% coverage: 185:605/605 of query aligns to 274:699/699 of Q06210
P14742 Glutamine--fructose-6-phosphate aminotransferase [isomerizing]; GFAT; D-fructose-6-phosphate amidotransferase; Hexosephosphate aminotransferase; EC 2.6.1.16 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
37% identity, 72% coverage: 171:605/605 of query aligns to 278:717/717 of P14742
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 active site, For GATase activity
2zj4A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
42% identity, 60% coverage: 245:605/605 of query aligns to 3:365/365 of 2zj4A
- active site: E238 (= E478), K242 (= K482), E245 (= E485), H261 (= H501), K360 (= K600)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T60 (= T298), S61 (= S299), S105 (= S343), Q106 (= Q344), S107 (= S345), T110 (= T348), V156 (= V395), A157 (= A396), K242 (= K482), E245 (= E485)
2zj3A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
42% identity, 60% coverage: 245:605/605 of query aligns to 3:365/365 of 2zj3A
- active site: E238 (= E478), K242 (= K482), E245 (= E485), H261 (= H501), K360 (= K600)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (= T298), S61 (= S299), S105 (= S343), Q106 (= Q344), S107 (= S345), T110 (= T348), V156 (= V395), A359 (= A599), K360 (= K600)
2v4mA The isomerase domain of human glutamine-fructose-6-phosphate transaminase 1 (gfpt1) in complex with fructose 6-phosphate
40% identity, 58% coverage: 245:593/605 of query aligns to 2:352/352 of 2v4mA
- active site: E237 (= E478), K241 (= K482), E244 (= E485), H260 (= H501)
- binding fructose -6-phosphate: T59 (= T298), S60 (= S299), S104 (= S343), Q105 (= Q344), S106 (= S345), T109 (= T348), A156 (= A396), S157 (= S397), K241 (= K482), E244 (= E485)
1xfgA Glutaminase domain of glucosamine 6-phosphate synthase complexed with l-glu hydroxamate (see paper)
55% identity, 38% coverage: 2:231/605 of query aligns to 1:232/238 of 1xfgA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N99), G99 (= G100)
- binding glutamine hydroxamate: C1 (= C2), R73 (= R73), W74 (= W74), T76 (= T76), H86 (= H86), N98 (= N99), G99 (= G100), D123 (= D124)
1xffA Glutaminase domain of glucosamine 6-phosphate synthase complexed with glutamate (see paper)
55% identity, 38% coverage: 2:231/605 of query aligns to 1:232/238 of 1xffA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W74), N98 (= N99), G99 (= G100)
- binding glutamic acid: C1 (= C2), R73 (= R73), W74 (= W74), T76 (= T76), H86 (= H86), N98 (= N99), G99 (= G100), D123 (= D124)
2pocB The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
40% identity, 58% coverage: 246:593/605 of query aligns to 1:352/352 of 2pocB
- active site: E236 (= E478), K240 (= K482), E243 (= E485), H259 (= H501)
- binding 6-O-phosphono-beta-D-glucopyranose: C55 (= C296), T57 (= T298), S58 (= S299), S102 (= S343), Q103 (= Q344), S104 (= S345), T107 (= T348), E243 (= E485)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (≠ A269), G36 (≠ A281), G126 (≠ A368), V128 (≠ C370), S136 (≠ V378), T139 (= T381), C141 (≠ F383), G142 (≠ S384), V143 (≠ F385), H144 (≠ L386)
2puvA The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
38% identity, 58% coverage: 245:593/605 of query aligns to 1:338/338 of 2puvA
- active site: E237 (= E478), K241 (= K482), E244 (= E485)
- binding 5-amino-5-deoxy-1-o-phosphono-d-mannitol: C56 (= C296), T58 (= T298), S103 (= S343), Q104 (= Q344), S105 (= S345), T108 (= T348), A155 (= A396), E244 (= E485)
- binding uridine-diphosphate-n-acetylglucosamine: R25 (≠ A269), G37 (≠ A281), G127 (≠ A368), V129 (≠ C370), S137 (≠ V378), T140 (= T381), C142 (≠ F383), G143 (≠ S384), V144 (≠ F385), H145 (≠ L386)
2putA The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
38% identity, 58% coverage: 246:593/605 of query aligns to 1:339/339 of 2putA
- active site: E236 (= E478), K240 (= K482), E243 (= E485)
- binding fructose -6-phosphate: C55 (= C296), T57 (= T298), S102 (= S343), Q103 (= Q344), S104 (= S345), T107 (= T348), A154 (= A396), S155 (= S397), K240 (= K482)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (≠ A269), G36 (≠ A281), G126 (≠ A368), V128 (≠ C370), S136 (≠ V378), T139 (= T381), C141 (≠ F383), G142 (≠ S384), V143 (≠ F385), H144 (≠ L386)
Query Sequence
>BPHYT_RS18560 FitnessBrowser__BFirm:BPHYT_RS18560
MCGIVGAVAQRNIVPVLIEGLRRLEYRGYDSCGVAVLGKDGPRRARSVARVADLDEQVRE
SHLEGITGIAHTRWATHGAPVTDNAHPIFSKDALALVHNGIIENYESLREMLRGKGYTFV
SQTDTEVIAHLIHSLYRGDLFAAVRETVGQLHGAYAIAVLHKDQPHTVVGARQGSPLVVG
LGQGENFLASDALALAGSTERFIFLEEGDVCELSLDGVRIADRDGNEAQREVRQVAAYGG
AVELGPYRHFMQKEIFEQPRAITDTIPQADSFDASLFGEGAGKVFAEIDSLLILACGTSY
YSGLTAKYWLESIAKIPTQVEIASEYRYRESVANPKSLVVVISQSGETADTLAALKHAQE
LGHKHTLAVCNVGTSAMVRQTEFSFLTHAGREIGVASTKAFTTQLVALFVLAATLGKMRG
RVSDEQEAEYLKQLRHLPAALNSVLALEPQIIAWSEEFSRKEHALFLGRGLHYPIALEGA
LKLKEISYIHAEAYPAGELKHGPLALVTEAMPVVTVAPNDALLEKLKSNIQEVRARGGEL
YVFADADTKIVNDEGLHVIRMPEHYGLLSPILHVVPLQLLAYHTACARGTDVDKPRNLAK
SVTVE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory