SitesBLAST
Comparing BPHYT_RS19520 FitnessBrowser__BFirm:BPHYT_RS19520 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ltvA Crystal structure of chromobacterium violaceum phenylalanine hydroxylase, structure with bound oxidized fe(iii) (see paper)
65% identity, 88% coverage: 22:282/296 of query aligns to 18:275/275 of 1ltvA
3tcyA Crystallographic structure of phenylalanine hydroxylase from chromobacterium violaceum (cpah) bound to phenylalanine in a site distal to the active site (see paper)
64% identity, 91% coverage: 14:282/296 of query aligns to 11:277/277 of 3tcyA
- active site: H132 (= H134), H137 (= H139), E178 (= E180), S197 (= S202)
- binding cobalt (ii) ion: H132 (= H134), H137 (= H139), E178 (= E180)
- binding phenylalanine: A152 (= A154), Y153 (= Y155), K159 (≠ A161), L169 (= L171), T248 (≠ A253), P250 (≠ T255), D251 (= D256), F252 (= F257)
4etlA Crystallographic structure of phenylalanine hydroxylase from chromobacterium violaceum f258a mutation (see paper)
63% identity, 91% coverage: 14:282/296 of query aligns to 11:277/277 of 4etlA
1ltzA Crystal structure of chromobacterium violaceum phenylalanine hydroxylase, structure has bound iron (iii) and oxidized cofactor 7, 8-dihydrobiopterin (see paper)
64% identity, 91% coverage: 14:282/296 of query aligns to 11:274/274 of 1ltzA
2v27B Structure of the cold active phenylalanine hydroxylase from colwellia psychrerythraea 34h (see paper)
41% identity, 77% coverage: 36:263/296 of query aligns to 21:247/272 of 2v27B
5jk5A Phenylalanine hydroxylase from dictyostelium - bh2 complex
36% identity, 75% coverage: 28:248/296 of query aligns to 149:368/400 of 5jk5A
- active site: H259 (= H134), H264 (= H139), E304 (= E180), S323 (= S202)
- binding fe (iii) ion: H259 (= H134), H264 (= H139), E304 (= E180)
- binding 7,8-dihydrobiopterin: G221 (= G96), L222 (= L97), L223 (≠ V98), F228 (= F103), L229 (≠ F104), S296 (≠ A172), Y299 (= Y175)
- binding piperazine-n,n'-bis(2-ethanesulfonic acid): T212 (= T87), P271 (= P146), D275 (= D150)
Sites not aligning to the query:
5jk8A Phenylalanine hydroxylase from dictyostelium - bh2, norleucine complex
36% identity, 75% coverage: 28:248/296 of query aligns to 140:359/390 of 5jk8A
- active site: H250 (= H134), H255 (= H139), E295 (= E180), S314 (= S202)
- binding fe (iii) ion: H250 (= H134), H255 (= H139), E295 (= E180)
- binding 7,8-dihydrobiopterin: L214 (≠ V98), A216 (≠ D100), F219 (= F103), S287 (≠ A172), Y290 (= Y175)
- binding norleucine: Y242 (= Y126), T243 (≠ L127), H250 (= H134), S314 (= S202), S315 (= S203)
- binding piperazine-n,n'-bis(2-ethanesulfonic acid): T203 (= T87), R226 (= R110), D266 (= D150)
Sites not aligning to the query:
6zn2A Partial structure of tyrosine hydroxylase in complex with dopamine showing the catalytic domain and an alpha-helix from the regulatory domain involved in dopamine binding. (see paper)
34% identity, 89% coverage: 28:289/296 of query aligns to 58:319/335 of 6zn2A
2xsnA Crystal structure of human tyrosine hydroxylase catalytic domain
34% identity, 89% coverage: 28:289/296 of query aligns to 59:320/335 of 2xsnA
6zvpD Atomic model of the em-based structure of the full-length tyrosine hydroxylase in complex with dopamine (residues 40-497) in which the regulatory domain (residues 40-165) has been included only with the backbone atoms (see paper)
34% identity, 89% coverage: 28:289/296 of query aligns to 181:442/458 of 6zvpD
Sites not aligning to the query:
P07101 Tyrosine 3-monooxygenase; Tyrosine 3-hydroxylase; TH; EC 1.14.16.2 from Homo sapiens (Human) (see 32 papers)
34% identity, 89% coverage: 28:289/296 of query aligns to 251:512/528 of P07101
- E259 (≠ D36) to G: in ARSEGS; complete loss of tyrosine 3-monooxygenase activity
- T276 (≠ G53) to P: in ARSEGS; parkinsonian symptoms in infancy; no effect on tyrosine 3-monooxygenase activity; dbSNP:rs28934581
- P301 (= P74) to A: in ARSEGS; loss of over 80% of tyrosine 3-monooxygenase activity
- F309 (≠ K82) to S: in ARSEGS; complete loss of tyrosine 3-monooxygenase activity
- T314 (= T87) to M: in ARSEGS; parkinsonian symptoms in infancy; loss of about 80% of tyrosine 3-monooxygenase activity; dbSNP:rs121917764
- R319 (≠ V92) to P: in ARSEGS; complete loss of tyrosine 3-monooxygenase activity
- R328 (≠ Q101) to W: in ARSEGS; complete loss of tyrosine 3-monooxygenase activity; dbSNP:rs1428589694
- R337 (= R110) to H: in ARSEGS; parkinsonian symptoms in infancy; no effect on tyrosine 3-monooxygenase activity; dbSNP:rs28934580
- C359 (= C132) to F: in ARSEGS; loss of over 80% of tyrosine 3-monooxygenase activity; dbSNP:rs121917765
- F375 (= F148) to L: in ARSEGS; loss of over 80% of tyrosine 3-monooxygenase activity; shifted substrate specificity from tyrosine to phenylalanine and Dopa; dbSNP:rs763198914
- A376 (= A149) to V: in ARSEGS; loss of over 80% of tyrosine 3-monooxygenase activity
- L387 (= L160) to M: in ARSEGS; no effect on tyrosine 3-monooxygenase activity
- I394 (≠ L168) to T: in ARSEGS; complete loss of tyrosine 3-monooxygenase activity
- T399 (≠ R173) to M: in ARSEGS; loss of over 80% of tyrosine 3-monooxygenase activity; dbSNP:rs1057520384
- Q412 (≠ D186) to K: in ARSEGS; loss of over 80% of tyrosine 3-monooxygenase activity; reduced affinity for L-tyrosine; dbSNP:rs121917762
- G414 (= G192) to R: in ARSEGS; loss of over 80% of tyrosine 3-monooxygenase activity; dbSNP:rs370962049
- G428 (= G205) to R: in ARSEGS; phenotype with prominent levodopa-responsive myoconus-dystonia (M-D); dbSNP:rs1264884607
- R441 (≠ L219) to P: in ARSEGS; complete loss of tyrosine 3-monooxygenase activity; dbSNP:rs367874223
- S467 (≠ D245) to G: in ARSEGS; loss of over 80% of tyrosine 3-monooxygenase activity
- P492 (= P268) to L: in ARSEGS; complete loss of tyrosine 3-monooxygenase activity; dbSNP:rs767635052
- T494 (≠ L270) to M: in ARSEGS; parkinsonian symptoms in infancy; no effect on tyrosine 3-monooxygenase activity; dbSNP:rs45471299
- D498 (= D274) to G: in ARSEGS; loss of over 80% of tyrosine 3-monooxygenase activity; dbSNP:rs771351747
- V499 (= V275) to M: in dbSNP:rs1800033
- L510 (≠ Q287) to Q: in ARSEGS; complete loss of tyrosine 3-monooxygenase activity
Sites not aligning to the query:
- 19 modified: Phosphoserine; by CaMK2; S → C: found in a patient with ARSEGS; uncertain significance; dbSNP:rs766704202
- 62 modified: Phosphoserine; S→A: Affects subcellular localization. Accumulates mainly in the soma of the neuroblastoma cells.; S→E: Does not affect subcellular localization. Distributed throughout the soma and neurites.
- 71 modified: Phosphoserine; by CaMK2 and PKA; S→E: Suppresses feedback inhibition induced by dopamine. Suppresses feedback inhibition induced by dopamine; when associated with A-207.
- 112 V → M: in dbSNP:rs6356
- 207 C → Y: in ARSEGS; loss of over 80% of tyrosine 3-monooxygenase activity; C→A: Suppresses the decrease in tyrosine 3-monooxygenase activity induced by NEM modification. Suppresses feedback inhibition induced by dopamine; when associated with E-71.
- 227 D → G: in ARSEGS; complete loss of tyrosine 3-monooxygenase activity
- 233 R → H: in ARSEGS; loss of over 80% of tyrosine 3-monooxygenase activity; shifted substrate specificity from tyrosine to phenylalanine and Dopa; dbSNP:rs80338892
- 236 L → P: in ARSEGS; severe parkinsonian symptoms in early infancy; strongly reduced stability and tyrosine 3-monooxygenase activity; rare mutation; dbSNP:rs121917763
- 241 A → T: in ARSEGS; loss of over 80% of tyrosine 3-monooxygenase activity; dbSNP:rs1260455415
- 246 H → Y: in ARSEGS; loss of about 40% of tyrosine 3-monooxygenase activity
- 247 G → S: in ARSEGS; loss of about 50% of tyrosine 3-monooxygenase activity; shifted substrate specificity from tyrosine to phenylalanine and Dopa; dbSNP:rs762304556
P04177 Tyrosine 3-monooxygenase; Tyrosine 3-hydroxylase; TH; EC 1.14.16.2 from Rattus norvegicus (Rat) (see 7 papers)
33% identity, 87% coverage: 28:285/296 of query aligns to 221:479/498 of P04177
- Q310 (≠ P113) mutation to H: Does not affect Vmax for phenylalanine. Increases KM for phenylalanine.
- H323 (≠ Y126) mutation to Y: Does not affect Vmax for phenylalaninet. Increases KM for phenylalanine.
- H331 (= H134) binding
- H336 (= H139) binding
- W372 (= W176) mutation to F: Does not affect substrate specificity.
- E376 (= E180) binding
- D425 (≠ I233) Important for substrate specificity; mutation to V: Shifts substrate specificity from tyrosine to phenylalanine.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 19 modified: Phosphoserine; by CaMK2
- 31 modified: Phosphoserine
- 40 modified: Phosphoserine; by CaMK2 and PKA
2tohA Tyrosine hydroxylase catalytic and tetramerization domains from rat (see paper)
33% identity, 89% coverage: 28:289/296 of query aligns to 59:320/336 of 2tohA
- active site: H169 (= H134), H174 (= H139), E214 (= E180), S233 (= S202)
- binding fe (iii) ion: H169 (= H134), H174 (= H139), E214 (= E180)
- binding 7,8-dihydrobiopterin: V129 (= V94), L132 (= L97), L133 (≠ V98), Y138 (≠ F103), P165 (= P130), E170 (≠ D135), Y209 (= Y175)
P17289 Tyrosine 3-monooxygenase; Tyrosine 3-hydroxylase; TH; EC 1.14.16.2 from Bos taurus (Bovine) (see 2 papers)
34% identity, 74% coverage: 28:247/296 of query aligns to 214:432/491 of P17289
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 19 modified: Phosphoserine; by CaMK2
- 31 modified: Phosphoserine
- 40 modified: Phosphoserine; by CaMK2 and PKA
P04176 Phenylalanine-4-hydroxylase; PAH; Phe-4-monooxygenase; EC 1.14.16.1 from Rattus norvegicus (Rat) (see 2 papers)
33% identity, 74% coverage: 28:247/296 of query aligns to 175:393/453 of P04176
- H285 (= H134) binding
- H290 (= H139) binding
- E330 (= E180) binding
Sites not aligning to the query:
- 16 modified: Phosphoserine; by PKA
5fgjA Structure of tetrameric rat phenylalanine hydroxylase, residues 1-453 (see paper)
33% identity, 74% coverage: 28:247/296 of query aligns to 153:371/428 of 5fgjA
P16331 Phenylalanine-4-hydroxylase; PAH; Phe-4-monooxygenase; EC 1.14.16.1 from Mus musculus (Mouse) (see paper)
34% identity, 74% coverage: 28:246/296 of query aligns to 175:392/453 of P16331
- F263 (= F112) mutation to S: Mutant mice have features of phenylketonuria.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 106 V→A: Mutant mice have mild features of phenylketonuria.
P00439 Phenylalanine-4-hydroxylase; PAH; Phe-4-monooxygenase; EC 1.14.16.1 from Homo sapiens (Human) (see 43 papers)
33% identity, 74% coverage: 28:246/296 of query aligns to 175:392/452 of P00439
- R176 (≠ T29) to L: in non-PKU HPA and PKU; dbSNP:rs74486803
- V177 (≠ E30) to L: in PKU; haplotype 6; dbSNP:rs199475602
- E178 (≠ R31) to G: in non-PKU HPA; dbSNP:rs77958223
- V190 (≠ L43) to A: in PKU; haplotype 3; dbSNP:rs62514919
- H201 (≠ R54) to Y: in non-PKU HPA; haplotype 1; dbSNP:rs62517205
- Y204 (≠ D57) to C: in PKU; mild; haplotypes 3,4; dbSNP:rs62514927
- N207 (≠ L60) to S: in PKU; severe; haplotype 4; dbSNP:rs62508721
- P211 (≠ D64) to T: in PKU; haplotype 4; dbSNP:rs62514931
- L213 (≠ I66) to P: in PKU; severe; dbSNP:rs62516109
- G218 (= G67) to V: in PKU; haplotypes 1,2; dbSNP:rs62514933
- E221 (≠ P70) to G: in PKU; haplotype 4; dbSNP:rs62514934
- D222 (= D71) to V: in PKU; haplotypes 3,4; dbSNP:rs62507319
- I224 (≠ V73) to M: in PKU; haplotype 4; dbSNP:rs199475576
- P225 (= P74) to T: in PKU; haplotype 1; dbSNP:rs199475589
- V230 (≠ I79) to I: in non-PKU HPA and PKU; haplotype 4; dbSNP:rs62516152
- F233 (≠ K82) to L: in PKU; haplotypes 2,3; dbSNP:rs62517208
- T238 (= T87) to P: in PKU; haplotype 4; dbSNP:rs199475577
- R241 (≠ E90) to C: in non-PKU HPA and PKU; haplotype 34; dbSNP:rs76687508; to H: in PKU; haplotypes 1,5; dbSNP:rs62508730
- R243 (≠ V92) to Q: in non-PKU HPA and PKU; haplotypes 4,7,9; dbSNP:rs62508588
- P244 (≠ A93) to L: in PKU; haplotype 12; dbSNP:rs118203923
- V245 (= V94) to A: in PKU, HPA and non-PKU HPA; haplotypes 3,7; dbSNP:rs796052017; to E: in PKU; haplotype 11; dbSNP:rs76212747
- G247 (= G96) to V: in PKU; haplotype 4; dbSNP:rs199475579
- L249 (≠ V98) to F: in PKU; haplotype 1; dbSNP:rs74503222
- R252 (≠ Q101) to G: in PKU; haplotype 7; dbSNP:rs5030847; to Q: in PKU; haplotype 1; dbSNP:rs62644503; to W: in PKU; haplotypes 1,6,7,8,42, 69; complete loss of activity; dbSNP:rs5030847
- L255 (≠ F104) to S: in PKU; haplotype 36; dbSNP:rs62642930; to V: in PKU; haplotypes 18,21; dbSNP:rs62642931
- A259 (= A108) to T: in PKU; haplotype 3; dbSNP:rs62642932; to V: in PKU; haplotypes 7,42; dbSNP:rs118203921
- R261 (= R110) to Q: in HPA and PKU; mild; haplotypes 1,2,4,22, 24,28; dbSNP:rs5030849
- I269 (≠ M118) to L: in non-PKU HPA; dbSNP:rs62508692
- R270 (= R119) to S: in PKU; haplotype 1; dbSNP:rs62514951
- S273 (≠ D122) to F: in PKU; haplotype 7; dbSNP:rs62514953
- P275 (≠ L124) to L: in PKU; reduced activity; increased affinity for the substrate; mildly reduced substrate activation; decreased cofactor affinity; dbSNP:rs62508715
- M276 (≠ D125) to V: in PKU; haplotype 4; dbSNP:rs62516149
- Y277 (= Y126) to D: in PKU; haplotype 2; dbSNP:rs78655458
- E280 (= E129) to K: in PKU; haplotypes 1,2,4,16,38; partial residual activity; dbSNP:rs62508698
- P281 (= P130) to L: in PKU; haplotypes 1,4; dbSNP:rs5030851
- D282 (= D131) to N: in PKU; haplotype 1; dbSNP:rs199475582
- I283 (≠ C132) to F: in PKU; haplotype 21; dbSNP:rs62517168; to N: in PKU; severe; dbSNP:rs62508693; mutation to C: Loss of positive cooperativity and reduction of fold-activation by L-Phe preincubation.
- R297 (≠ P146) to C: in PKU; haplotype 4; dbSNP:rs62642945
- F299 (= F148) to C: in PKU; haplotype 8; dbSNP:rs62642933
- A300 (= A149) to S: in PKU and HPA; haplotype 1; does not affect oligomerization; reduction in activity is probably due to a global conformational change in the protein that reduces allostery; dbSNP:rs5030853
- S303 (≠ M152) to P: in PKU; haplotype 5; dbSNP:rs199475608
- I306 (≠ Y155) to V: in non-PKU HPA and PKU; haplotype 4; dbSNP:rs62642934
- A309 (= A158) to D: in PKU; haplotype 7; dbSNP:rs62642935
- S310 (≠ A159) to F: in PKU; haplotype 7; dbSNP:rs62642913; to Y: in HPA; reduction in activity is probably due to a global conformational change in the protein that reduces allostery; dbSNP:rs62642913
- L311 (= L160) to P: in PKU; haplotypes 1,7,10; dbSNP:rs62642936
- P314 (≠ H163) to S: in HPA; does not affect oligomerization; reduction in activity is probably due to a global conformational change in the protein that reduces allostery; dbSNP:rs199475650
- I318 (≠ L168) to T: in PKU; partial loss of activity; dbSNP:rs62642918
- A322 (= A172) to G: in PKU; haplotype 12; dbSNP:rs62514958; to T: in PKU; haplotype 1; dbSNP:rs62514957
- F331 (= F181) to L: in PKU; haplotype 1; dbSNP:rs62517179
- D338 (≠ A188) to Y: in PKU; haplotype 4; dbSNP:rs62516150
- A342 (≠ I195) to T: in PKU; haplotype 5; dbSNP:rs62507282
- A345 (= A198) to T: in PKU; haplotype 7; dbSNP:rs62516062
- L348 (≠ V201) to V: in PKU; mild haplotype 9; dbSNP:rs62516092
- S349 (= S202) to L: in PKU; severe; dbSNP:rs62507279; to P: in PKU; haplotypes 1,4; dbSNP:rs62508646
- S350 (= S203) to T: in PKU; haplotype 2; dbSNP:rs62517183
- L364 (≠ R218) natural variant: Missing (in PKU; haplotype 5; dbSNP:rs62516096)
- Y377 (= Y231) to C: in PKU; haplotype 4; dbSNP:rs62642942
- T380 (≠ D234) to M: in non-PKU HPA and PKU; haplotype 4; dbSNP:rs62642937
- Y387 (≠ F241) to H: in PKU; haplotype 1; dbSNP:rs62517194
- V388 (= V242) to M: in PKU; haplotypes 1,4; dbSNP:rs62516101
- E390 (≠ D244) to G: in PKU and non-PKU HPA; haplotype 4; dbSNP:rs5030856
Sites not aligning to the query:
- 16 modified: Phosphoserine; by PKA; S → P: in PKU; uncertain significance; dbSNP:rs62642946
- 39 F → L: in HPA and PKU; haplotype 1; dbSNP:rs62642926; natural variant: Missing (in PKU; haplotypes 9,21)
- 41 L → P: in PKU; mild; dbSNP:rs62642916
- 42 K → I: in PKU; haplotype 21; dbSNP:rs62635346
- 46 G → S: in PKU; haplotype 5; significantly reduces phenylalanine binding; dbSNP:rs74603784
- 47 A → V: in non-PKU HPA; haplotype 4; significantly reduces phenylalanine binding; dbSNP:rs118203925
- 48 L → S: in PKU; mild; haplotypes 3,4; dbSNP:rs5030841
- 55 F → L: in HPA and PKU; does not affect oligomerization; results in loss of substrate activation; dbSNP:rs199475598
- 56 E → D: in PKU; haplotype 10; dbSNP:rs199475567
- 63:64 natural variant: TH -> PN (in PKU; haplotype 1; abolishes phenylalanine binding)
- 65 I → S: in PKU; results in disturbed oligomerization; results in loss of substrate activation; dbSNP:rs75193786; I → T: in PKU; haplotypes 1,5,9,21,B; abolishes phenylalanine binding; dbSNP:rs75193786; I → V: in HPA and PKU; dbSNP:rs199475643
- 67 S → P: in PKU; haplotype 4; dbSNP:rs5030842
- 68 R → S: in PKU; haplotype 1; dbSNP:rs76394784
- 76 E → G: in non-PKU HPA; dbSNP:rs62507347
- 84 D → Y: in PKU; haplotype 4; dbSNP:rs62514902
- 87 S → R: in non-PKU HPA; haplotype 1; dbSNP:rs62516151
- 94 natural variant: Missing (in PKU; mild; haplotype 2)
- 98 L → S: in non-PKU HPA; dbSNP:rs62517167
- 104 A → D: in PKU; mild; haplotype 1; dbSNP:rs62642929
- 124 T → I: in PKU; haplotype 28; dbSNP:rs199475571
- 143 D → G: in PKU; haplotype 11; dbSNP:rs199475572
- 148 G → S: in PKU; haplotypes 1,2,7; dbSNP:rs80297647
- 151 D → H: in PKU; haplotypes 1,8; dbSNP:rs199475597
- 157 R → N: in PKU; severe; 5% activity; requires 2 nucleotide substitutions; dbSNP:rs1565853495
- 158 R → Q: in PKU; haplotypes 1,2,4,7,16, 28; dbSNP:rs5030843
- 161 F → S: in PKU; haplotype 4; dbSNP:rs79635844
- 164 I → T: in PKU; haplotype 1; dbSNP:rs199475595
- 170 H → Q: in PKU; does not affect oligomerization; dbSNP:rs199475652
- 171 G → A: in PKU; haplotype 1; dbSNP:rs199475596
- 173 P → T: in PKU; haplotype 4; dbSNP:rs199475574
- 174 I → T: in PKU; haplotype 1; dbSNP:rs138809906
- 395 A → P: in PKU; haplotype 1; dbSNP:rs62516103
- 403 A → V: in non-PKU HPA and PKU; haplotype 43; dbSNP:rs5030857
- 408 R → Q: in PKU; haplotypes 4,12; dbSNP:rs5030859; R → W: in HPA and PKU; haplotypes 1,2,4,5,13,34,41,44; most common mutation; reduction in activity is probably due to a global conformational change in the protein that reduces allostery; dbSNP:rs5030858
- 410 F → S: in PKU; mild; dbSNP:rs62644475
- 413 R → P: in non-PKU HPA and PKU; haplotype 4; dbSNP:rs79931499; R → S: in PKU; haplotype 1; dbSNP:rs62644467
- 414 Y → C: in HPA and PKU; haplotype 4; does not affect oligomerization; reduction in activity is probably due to a global conformational change in the protein that reduces allostery; dbSNP:rs5030860
- 415 D → N: in PKU, HPA and non-PKU HPA; haplotype 1; dbSNP:rs62644499
- 417 Y → H: in PKU; reduction in activity is probably due to a global conformational change in the protein that reduces allostery; dbSNP:rs62644471
- 418 T → P: in PKU; haplotype 4; dbSNP:rs62644501
1kw0A Catalytic domain of human phenylalanine hydroxylase (fe(ii)) in complex with tetrahydrobiopterin and thienylalanine (see paper)
33% identity, 74% coverage: 28:246/296 of query aligns to 58:275/307 of 1kw0A
- active site: H168 (= H134), H173 (= H139), E213 (= E180), S232 (= S202)
- binding fe (ii) ion: H168 (= H134), H173 (= H139), E213 (= E180)
- binding 5,6,7,8-tetrahydrobiopterin: L131 (= L97), L132 (≠ V98), S134 (≠ D100), F137 (= F103), H147 (≠ P113), E169 (≠ D135), E213 (= E180)
- binding beta(2-thienyl)alanine: R153 (= R119), Y160 (= Y126), T161 (≠ L127), E163 (= E129), P164 (= P130), H168 (= H134), F214 (= F181), S232 (= S202), S233 (= S203)
1j8uA Catalytic domain of human phenylalanine hydroxylase fe(ii) in complex with tetrahydrobiopterin (see paper)
33% identity, 74% coverage: 28:246/296 of query aligns to 58:275/307 of 1j8uA
- active site: H168 (= H134), H173 (= H139), E213 (= E180), S232 (= S202)
- binding fe (ii) ion: H168 (= H134), H173 (= H139), E213 (= E180)
- binding 5,6,7,8-tetrahydrobiopterin: L132 (≠ V98), S134 (≠ D100), F137 (= F103), L138 (≠ F104), A205 (= A172)
Query Sequence
>BPHYT_RS19520 FitnessBrowser__BFirm:BPHYT_RS19520
MSTANTAKLKEQFHAGLETRADFTIDQPTERYGAVDHAVWQQLYARQTALLKGRVCDEFL
AGIDTIGMPPDRVPSFDEINAKLAPATGWEIVAVPGLVPDQVFFEHLANRRFPVTWWMRR
PDQLDYLQEPDCFHDLFGHVPLLINPVFADYMHAYGRAALAAHDAGALPLLARLYWYTVE
FGLIRDAASPNGVKIYGAGIVSSKGETLYSQQSAAPNRLGFGLERVMRTRYRIDTFQKTY
FVIDDFAQLFKVAQTDFAPLLAKLVAEPALAAGDVLEHDRVITRGSQEGWLADGDI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory