Comparing BPHYT_RS19720 FitnessBrowser__BFirm:BPHYT_RS19720 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
45% identity, 96% coverage: 23:515/515 of query aligns to 2:494/501 of P04983
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
32% identity, 40% coverage: 34:237/515 of query aligns to 10:212/240 of 4ymuJ
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 47% coverage: 26:267/515 of query aligns to 5:251/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 47% coverage: 26:267/515 of query aligns to 5:251/253 of 1g9xB
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
32% identity, 39% coverage: 38:240/515 of query aligns to 20:221/615 of 5lilA
Sites not aligning to the query:
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
32% identity, 39% coverage: 38:240/515 of query aligns to 20:221/592 of 5lj7A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 42% coverage: 26:241/515 of query aligns to 2:221/343 of P30750
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 42% coverage: 24:240/515 of query aligns to 1:214/241 of 4u00A
7arlD Lolcde in complex with lipoprotein and adp (see paper)
31% identity, 38% coverage: 41:238/515 of query aligns to 22:219/222 of 7arlD
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
31% identity, 38% coverage: 41:238/515 of query aligns to 25:222/233 of P75957
7mdyC Lolcde nucleotide-bound
31% identity, 38% coverage: 41:238/515 of query aligns to 22:219/226 of 7mdyC
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
33% identity, 42% coverage: 26:241/515 of query aligns to 3:222/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
33% identity, 42% coverage: 26:241/515 of query aligns to 3:222/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
33% identity, 42% coverage: 26:241/515 of query aligns to 3:222/344 of 6cvlD
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 43% coverage: 20:238/515 of query aligns to 12:225/378 of P69874
Sites not aligning to the query:
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
32% identity, 47% coverage: 28:268/515 of query aligns to 14:246/265 of P07821
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
31% identity, 38% coverage: 41:238/515 of query aligns to 24:221/229 of 7v8iD
Sites not aligning to the query:
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
32% identity, 42% coverage: 24:237/515 of query aligns to 3:219/648 of P75831
3c4jA Abc protein artp in complex with atp-gamma-s
31% identity, 40% coverage: 35:240/515 of query aligns to 13:216/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
31% identity, 40% coverage: 35:240/515 of query aligns to 13:216/242 of 3c41J
>BPHYT_RS19720 FitnessBrowser__BFirm:BPHYT_RS19720
MTSSHTESHAAQAAPSPALASTEPYLRLDGITVRFPGVLALDQVSLEVRRGEVHGLMGEN
GAGKSTLLKVLSGVNQPAAGTLSLDGVEQQFITTKAAIAAGVAIIYQELHLVPELTVAEN
LMLGALPNRFGILDEKALVARAVRELERLGEKIDPSQQVKNLSIGQRQMIEIGKALMRDA
RVIAFDEPTSSLSSRETTQLFRIIRALKAEGRAIIYVTHRMDEVYELCDRVTVFRDGRRI
DTFEAGEGLDRDRLISCMVGRSIADVYGYRSRDLGDVQLDVKEMMGRGLREPASFTARKG
EIVGFFGLVGAGRSELMKLIYGAVKPDAGEIALKGKRVRFATPRDAVRAGVALCPEDRKQ
EGIVSIASVSDNLNISCRRHFSRFNVLNGRKEAQTAKEFIGKLAIKTRNGDTPIGTLSGG
NQQKVILSRWLAEDIDVFLMDEPTRGIDVGARSEIYGLLYGLAEAGRTVIVVSSDLAEVI
GVADRVIVMKEGRIVGDLPKAQATPDALIKLALPR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory