SitesBLAST
Comparing BPHYT_RS20015 FitnessBrowser__BFirm:BPHYT_RS20015 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P77589 3-(3-hydroxy-phenyl)propionate transporter; 3HPP transporter; 3-(3-hydroxy-phenyl)propionate:H(+) symporter; 3HPP:H(+) symporter from Escherichia coli (strain K12) (see paper)
48% identity, 94% coverage: 26:414/415 of query aligns to 15:402/403 of P77589
- E27 (= E38) mutation to A: Lack of 3HPP transport activity.; mutation to D: Slight decrease in 3HPP transport activity.
- D75 (= D86) mutation D->A,E: Lack of 3HPP transport activity.
- A272 (≠ M289) mutation to H: 30% increase in 3HPP transport activity.
- K276 (≠ R293) mutation to D: Lack of 3HPP transport activity.
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
34% identity, 91% coverage: 31:408/415 of query aligns to 27:430/452 of Q5EXK5
- D82 (= D86) mutation to A: Loss of activity.
- V311 (≠ M289) mutation to W: Loss of activity.
- D314 (= D292) mutation to A: Loss of activity.
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
33% identity, 87% coverage: 30:392/415 of query aligns to 33:424/448 of Q51955
- D41 (≠ E38) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- D44 (= D41) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- G85 (= G82) mutation to V: Abolishes 4-HBA transport and chemotaxis.
- D89 (= D86) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- G92 (= G89) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to C: No change in 4-HBA transport and chemotaxis.; mutation G->L,V: Abolishes 4-HBA transport and chemotaxis.; mutation to Q: Decrease in 4-HBA transport and strong decrease in chemotaxis.
- R124 (= R121) mutation to A: Abolishes 4-HBA transport.
- E144 (= E141) mutation to A: Strong decrease in 4-HBA transport.
- H183 (≠ R180) mutation to A: Decrease in 4-HBA transport and chemotaxis.
- D323 (= D292) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- H328 (≠ G297) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to R: Decrease in 4-HBA transport and loss of chemotaxis.
- R386 (= R354) mutation to A: Strong decrease in 4-HBA transport.
- R398 (= R366) mutation to A: Abolishes 4-HBA transport.
Sites not aligning to the query:
- 444 H→A: No change in 4-HBA transport and chemotaxis.
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
32% identity, 90% coverage: 9:383/415 of query aligns to 27:403/444 of Q8NLB7
- D54 (≠ E38) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- D57 (= D41) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (= R87) mutation to A: Loss of transport activity.
- W309 (≠ M289) mutation to V: Loss of transport activity.
- D312 (= D292) mutation to A: Loss of transport activity.
- R313 (= R293) mutation to A: Loss of transport activity.
- I317 (≠ M294) mutation I->H,Y: Loss of transport activity.
- R386 (= R366) mutation to A: Loss of transport activity.
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
32% identity, 23% coverage: 73:169/415 of query aligns to 200:296/727 of Q9Z2I6
Sites not aligning to the query:
- 1:57 Interaction with SYT1
- 529:566 (Microbial infection) C.botulinum neurotoxin type A-binding
- 559 N→A: Loss of one glycosylation site. No effect on C.botulinum neurotoxin type A (BoNT/A, botA) binding, but reduces the uptake of BoNT/A.
Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
32% identity, 23% coverage: 73:169/415 of query aligns to 200:296/727 of Q496J9
Sites not aligning to the query:
- 519:563 (Microbial infection) C.botulinum neurotoxin type A-binding
- 534 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 559 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: No change in interaction with C.botulinum neurotoxin type A heavy chain (botA, BoNT/A HC). Decreased molecular weight probably due to glycosylation loss, decreased interaction with BoNT/A HC.; N→Q: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC. Greater reduction in weight; when associated with Q-565.
- 561 S→A: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC.
- 563 F→A: No longer interacts with BoNT/A HC.
- 565 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Decreased molecular weight probably due to glycosylation loss, no change in binding to BoNT/A heavy chain. Greater reduction in weight; when associated with Q-559.
Q02563 Synaptic vesicle glycoprotein 2A; Synaptic vesicle protein 2; Synaptic vesicle protein 2A from Rattus norvegicus (Rat) (see 2 papers)
29% identity, 29% coverage: 50:169/415 of query aligns to 191:310/742 of Q02563
- DMCLS 196:200 (≠ EFGLS 55:59) mutation Missing: No change in uptake of C.botulinum neurotoxin type D (BoNT/D, botD) or C.botulinum neurotoxin type E (BoNT/E).
Sites not aligning to the query:
- 321:331 mutation Missing: No change in uptake of BoNT/D or BoNT/E.
- 498 N→Q: No change in uptake of BoNT/E or C.botulinum neurotoxin type A (BoNT/A, botA) by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-548. No change in uptake of BoNT/D.
- 548 N→Q: No change in uptake of BoNT/E or BoNT/A by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-498. No change in uptake of BoNT/D.
- 570:573 RLVN→TLVQ: Restores apparent molecular weight to wild-type, does not restore uptake of BoNT/E.
- 573 N→Q: BoNT/E not taken up by mouse SV2A/SV2B knockout neurons, decreased uptake of BoNT/A; SV2A apparent molecular weight decreases. No change in uptake of BoNT/D.
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
22% identity, 95% coverage: 15:408/415 of query aligns to 3:423/430 of P0AA76
- Y29 (≠ G39) binding
- D31 (= D41) mutation to N: Loss of galactonate transport activity.
- R32 (≠ L42) binding
- Y64 (≠ L74) binding
- E118 (≠ L128) mutation to Q: Loss of galactonate transport activity.
- W358 (≠ Y342) binding
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
22% identity, 93% coverage: 25:408/415 of query aligns to 4:404/409 of 6e9nA
Q8BN82 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Mus musculus (Mouse) (see paper)
24% identity, 52% coverage: 45:259/415 of query aligns to 90:316/495 of Q8BN82
- H183 (≠ I136) mutation to R: Abolishes sialic acid transporter activity. Does not affect L-aspartate and L-glutamate transporter activity.
Sites not aligning to the query:
- 39 R→C: Completely abolishes L-aspartate and L-glutamate transporter activity. Retains appreciable H(+)-coupled sialic acid transporter activity.
P9WJY3 Probable triacylglyceride transporter Rv1410c; MFS-type drug efflux transporter P55 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
28% identity, 34% coverage: 82:221/415 of query aligns to 66:201/518 of P9WJY3
Sites not aligning to the query:
- 22 D→A: Susceptible to ethidium bromide, tested in M.smegmatis.; D→E: Decreases resistance to ethidium bromide, tested in M.smegmatis.
Q9NRA2 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein HP59; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Homo sapiens (Human) (see 8 papers)
23% identity, 86% coverage: 40:396/415 of query aligns to 74:442/495 of Q9NRA2
- K136 (= K91) to E: in SD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transporter activity, but retains appreciable H(+)-coupled sialic acid transporter activity; dbSNP:rs80338795
- H183 (≠ I136) to R: in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity; dbSNP:rs119491109
- LL 198:199 (≠ AV 151:152) mutation to AA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- IL 266:267 (≠ TK 208:209) mutation to LA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- SSLRN 268:272 (≠ ASRDG 210:214) natural variant: Missing (in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity)
- G328 (= G270) to E: in ISSD; some patients may manifest a milder phenotype consistent with Salla disease; markedly decreases H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs386833996
- P334 (≠ F276) to R: in ISSD; does not affect intracellular localization, targeted to lysosomes; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs119491110
- G371 (= G321) to V: in ISSD; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs777862172
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane.; LL→GG: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R → C: in SD; frequent variant in Finland; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transport activity, but retains appreciable H(+)-coupled sialic acid and nitrate transporter activity; dbSNP:rs80338794
Q94KE0 Sugar transporter ESL1; Protein EARLY-RESPONSIVE TO DEHYDRATION 6-LIKE 1; ERD six-like 1; Sugar transporter ERD6-like 3; Sugar transporter-like protein 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 38% coverage: 47:204/415 of query aligns to 55:207/470 of Q94KE0
Sites not aligning to the query:
- 10 L→A: Localizes mainly to the endoplasmic reticulum.
- 10:16 Essential for the localization to the vacuole membrane
- 14 L→A: Localizes to the plasma membrane. Loss of localization to the vacuole membrane; when associated with A-15 and A-16.
- 15 L→A: Localizes to the plasma membrane. Loss of localization to the vacuole membrane; when associated with A-14 and A-16.
- 16 L→A: Loss of localization to the vacuole membrane; when associated with A-14 and A-15.
6m2lA Crystal structure of plasmodium falciparum hexose transporter pfht1 bound with c3361 (see paper)
31% identity, 32% coverage: 77:207/415 of query aligns to 60:188/447 of 6m2lA
Sites not aligning to the query:
- binding (2S,3R,4S,5R,6R)-6-(hydroxymethyl)-4-undec-10-enoxy-oxane-2,3,5-triol: 25, 54, 265, 269, 366
6rw3A The molecular basis for sugar import in malaria parasites. (see paper)
31% identity, 32% coverage: 77:207/415 of query aligns to 60:193/437 of 6rw3A
Sites not aligning to the query:
Q4U2R8 Solute carrier family 22 member 6; Organic anion transporter 1; hOAT1; PAH transporter; hPAHT; Renal organic anion transporter 1; hROAT1 from Homo sapiens (Human) (see 6 papers)
28% identity, 42% coverage: 7:182/415 of query aligns to 91:250/563 of Q4U2R8
- N92 (= N8) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N97 (≠ T13) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- P104 (≠ S20) to L: in dbSNP:rs11568627
- N113 (≠ G29) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- Y230 (= Y156) mutation to A: Loss of membrane protein expression and little uptake of cidofovir.
Sites not aligning to the query:
- 7 L → P: in dbSNP:rs1415632329
- 30 L→A: Complete loss of PAH transport activity.
- 36 T→A: Complete loss of PAH transport activity.
- 39 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Complete loss of PAH transport activity.
- 50 R → H: lower Vmax; increase in substrate affinity and increase in the affinity for the nucleoside phosphonate analogs cidofovir, adefovir and tenofovir; dbSNP:rs11568626
- 56 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 431 K→A: Decrease in the level of membrane protein expression and 70 % loss of PAH uptake.
- 438 F→A: Decrease in the level of membrane protein expression, 70 % loss of PAH uptake, increased affinity for cidofovir, lower Vmax for PAH, and lower Km and Vmax for cidofovir.
Q5Q0U0 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 (Anion/sugar transporter), member 5; Vesicular excitatory amino acid transporter; VEAT from Rattus norvegicus (Rat) (see 2 papers)
24% identity, 52% coverage: 45:259/415 of query aligns to 90:316/495 of Q5Q0U0
- K136 (= K91) mutation to E: Markedly decreases H(+)-coupled sialic acid transporter activity.
- R168 (= R121) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- E171 (≠ T124) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-175.
- G172 (= G125) mutation to C: Decreases protein levels and alters subcellular localization.
- E175 (≠ L128) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-171.
- G176 (= G129) mutation to C: Decreases protein levels and alters subcellular localization.
- F179 (≠ L132) mutation to C: Decreases the affinity and transport rate for D-glucuronate. Does not affect H(+)-coupled sialic acid transporter activity.
- P180 (= P133) mutation to C: Decreases protein levels and alters subcellular localization.
- H183 (≠ I136) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- W186 (≠ S139) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- SSLKN 268:272 (≠ ASRDG 210:214) mutation Missing: Abolishes H(+)-coupled sialic acid transporter activity.
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R→C: Markedly decreases H(+)-coupled sialic acid transporter activity.
- 334 P→R: Abolishes H(+)-coupled sialic acid transporter activity.
- 371 G→V: Remains in the endoplasmic reticulum.
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
23% identity, 46% coverage: 25:213/415 of query aligns to 7:198/393 of 6e9oA
Sites not aligning to the query:
P36021 Monocarboxylate transporter 8; MCT 8; Monocarboxylate transporter 7; MCT 7; Solute carrier family 16 member 2; X-linked PEST-containing transporter from Homo sapiens (Human) (see 12 papers)
28% identity, 36% coverage: 77:227/415 of query aligns to 370:531/539 of P36021
- R371 (≠ A78) to C: in MCT8 deficiency; impaired homodimerization; dbSNP:rs587784384; mutation to A: Does not affect localization to the cell membrane. Abolishes T3 uptake activity.
- H376 (≠ R83) mutation to A: No effect on thyroid hormone (TH) transport.
- D379 (= D86) to V: in MCT8 deficiency; impaired thyroid hormone transporter activity; does not affect localization to the cell membrane
- L397 (≠ F101) to P: in MCT8 deficiency; does not affect homodimerization activity; dbSNP:rs122455132
- D424 (≠ L128) mutation to A: Does not affect localization to the cell membrane. Abolishes T3 uptake activity.
- F427 (≠ A131) natural variant: Missing (in MCT8 deficiency; dbSNP:rs113994164)
- L438 (≠ A142) to P: in MCT8 deficiency; does not affect homodimerization activity; dbSNP:rs104894931
- P463 (≠ I159) to L: in MCT8 deficiency; impaired thyroid hormone transporter activity; does not affect localization to the cell membrane
- G484 (= G187) to D: in MCT8 deficiency; does not affect homodimerization activity; impaired thyroid hormone transporter activity; impaired localization to the cell membrane
- G490 (vs. gap) to E: in MCT8 deficiency; results in a mild clinical phenotype; retains some residual thyroid hormone transporter activity; to R: in MCT8 deficiency; loss of thyroid hormone transport; dbSNP:rs794727799; mutation to A: No effect on thyroid hormone (TH) transport.
- L494 (= L196) to P: in MCT8 deficiency; does not affect homodimerization activity; dbSNP:rs104894938
Sites not aligning to the query:
- 118 H→A: Reduction of thyroid hormone (TH) transport.; H→Q: Does not alter kinetic characteristics of thyroid hormone (TH) transport.
- 120 S → F: in MCT8 deficiency; impaired homodimerization; dbSNP:rs113994162
- 147 G → R: in MCT8 deficiency; impaired thyroid hormone transporter activity; does not affect localization to the cell membrane; dbSNP:rs1602140936
- 150 A → T: in MCT8 deficiency; impaired homodimerization; dbSNP:rs373279555; A → V: in MCT8 deficiency; does not affect homodimerization activity; dbSNP:rs104894936
- 156 natural variant: Missing (in MCT8 deficiency; increased homodimerization activity)
- 161 V → M: in MCT8 deficiency; increased homodimerization activity
- 186 H→A: No effect on thyroid hormone (TH) transport.
- 197 R → H: in MCT8 deficiency; does not affect homodimerization activity; dbSNP:rs727504155
- 208 G → C: in MCT8 deficiency; impaired thyroid hormone transporter activity; impaired localization to the cell membrane
- 216 S → F: in MCT8 deficiency; decreased thyroid hormone transport; decreased protein abundance; decreased localization to the plasma membrane; dbSNP:rs398124232; S→A: No effect on thyroid hormone transport. No effect on protein abundance. No effect on protein localization to the plasma membrane.
- 217 L → R: in MCT8 deficiency; atypical form; characterized by developmental delay hypotonia and delayed myelination
- 247 P → L: in MCT8 deficiency; impaired thyroid hormone transporter activity; does not affect localization to the cell membrane
- 360 L → W: in MCT8 deficiency; impaired homodimerization; dbSNP:rs104894939
O59698 Uncharacterized transporter C36.01c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
23% identity, 41% coverage: 48:217/415 of query aligns to 161:329/580 of O59698
Sites not aligning to the query:
- 99 modified: Phosphoserine
Query Sequence
>BPHYT_RS20015 FitnessBrowser__BFirm:BPHYT_RS20015
MKRAGTLNSTEATTVPAASSRTGAFVTLGLCFAIALLEGLDLQSVGVAAPRMAREFGLSV
AQMGLAFSAGTFGLLPGAMFGGRLADRIGRKRVLVISACLFGLLSIMTALVSDFHTLVIV
RVLTGIGLGGALPNLIALSSEAVEPRSRGTAVSVMYCGIPFGGVIASVIGVLSAGDTEWR
HIFYVGGAGPLVLVPLLLVFLADSKAFTKASRDGQVKPAPVGEILFGGTRGLSTVQIWVS
YFCTLIVLYFLLNWLPSLMAASGLTRAQVGYVQIFFNIGGGIGALCIGMLMDRMRSGVVV
AGMYVGIIASLATLSTAHGFGALAASAFFAGMFVIGGQSVLYALSAAFYPTAMRGTGVGA
AVAVGRIGSVVGPLAAGQLLAMGRSSSTVIGASIPVTLIAAAAALLLLRRPRADD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory