Comparing BPHYT_RS20245 FitnessBrowser__BFirm:BPHYT_RS20245 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
5ggxD Crystal structure of fe3+ - desferal bound siderophore binding protein fhud from vibrio cholerae
34% identity, 74% coverage: 85:356/366 of query aligns to 5:265/267 of 5ggxD
P15028 Fe(3+) dicitrate-binding periplasmic protein FecB; Iron(III) dicitrate-binding periplasmic protein from Escherichia coli (strain K12) (see paper)
31% identity, 73% coverage: 78:346/366 of query aligns to 32:284/300 of P15028
7w8fA Crystal structure of siderophore binding protein vatd from vibrio vulnificus m2799 complexed with desferal
27% identity, 76% coverage: 76:353/366 of query aligns to 9:276/278 of 7w8fA
Q845T3 Ferric aerobactin-binding protein VatD; Iron(3+)-hydroxamate-binding protein VatD; Periplasmic-binding protein VatD; PBP VatD; Vulnificus aerobactin transport protein D from Vibrio vulnificus
27% identity, 76% coverage: 76:353/366 of query aligns to 21:288/292 of Q845T3
3lhsA Open conformation of htsa complexed with staphyloferrin a (see paper)
27% identity, 75% coverage: 79:351/366 of query aligns to 15:285/291 of 3lhsA
3li2A Closed conformation of htsa complexed with staphyloferrin a (see paper)
27% identity, 75% coverage: 79:351/366 of query aligns to 15:285/288 of 3li2A
O31567 Probable siderophore-binding lipoprotein YfiY from Bacillus subtilis (strain 168) (see paper)
38% identity, 33% coverage: 76:195/366 of query aligns to 47:171/325 of O31567
Sites not aligning to the query:
1eszA Structure of the periplasmic ferric siderophore binding protein fhud complexed with coprogen (see paper)
29% identity, 74% coverage: 82:353/366 of query aligns to 2:260/260 of 1eszA
P07822 Iron(3+)-hydroxamate-binding protein FhuD; Ferric hydroxamate uptake protein D; Ferrichrome-binding periplasmic protein; Iron(III)-hydroxamate-binding protein FhuD from Escherichia coli (strain K12) (see 3 papers)
29% identity, 79% coverage: 66:353/366 of query aligns to 16:292/296 of P07822
1k7sN Fhud complexed with albomycin-delta 2 (see paper)
29% identity, 74% coverage: 82:353/366 of query aligns to 3:261/262 of 1k7sN
1efdN Periplasmic ferric siderophore binding protein fhud complexed with gallichrome (see paper)
29% identity, 74% coverage: 82:353/366 of query aligns to 3:261/262 of 1efdN
1k2vN E. Coli periplasmic protein fhud complexed with desferal (see paper)
29% identity, 74% coverage: 82:353/366 of query aligns to 3:261/262 of 1k2vN
3tnyA Structure of yfiy from bacillus cereus bound to the siderophore iron (iii) schizokinen
35% identity, 26% coverage: 78:171/366 of query aligns to 13:106/280 of 3tnyA
Sites not aligning to the query:
6mflA Structure of siderophore binding protein baub bound to a complex between two molecules of acinetobactin and ferric iron. (see paper)
26% identity, 69% coverage: 83:334/366 of query aligns to 18:259/284 of 6mflA
Sites not aligning to the query:
3mwfA Crystal structure of staphylococcus aureus sira complexed with staphyloferrin b
27% identity, 41% coverage: 76:224/366 of query aligns to 10:148/292 of 3mwfA
Sites not aligning to the query:
P11460 Ferric-anguibactin-binding protein FatB from Vibrio anguillarum (strain ATCC 68554 / 775) (Listonella anguillarum) (see paper)
25% identity, 76% coverage: 58:334/366 of query aligns to 28:299/322 of P11460
Sites not aligning to the query:
3gfvB Crystal structure of petrobactin-binding protein yclq from bacillu subtilis (see paper)
25% identity, 41% coverage: 79:228/366 of query aligns to 17:155/285 of 3gfvB
Sites not aligning to the query:
7sf6A Crystal structure of siderophore binding protein fatb from desulfitobacterium hafniense
34% identity, 25% coverage: 78:169/366 of query aligns to 13:100/294 of 7sf6A
Sites not aligning to the query:
>BPHYT_RS20245 FitnessBrowser__BFirm:BPHYT_RS20245
MTSTTPSARGSRGEKKRPRFTQFCMNAVMAATLFSNAYAFAQGNGTAASPTQSNTAQAQP
QTCKPLADNPIVSQASPSLPAQPKRIVVLEFMFAEDLAAVGITPVGMADPEYYPVWIGYD
NARLASVPDIGTRQEPSLEAIAAAKPDLILGVGLRHAPIFAALERIAPTVLFKYGPNFTE
DGARVTQLDWGRKILRTIGCLTGREEAARAVEAKVDAGFARDAQRLAEAGRRGEQVAWLQ
ELGLPDRYWAFTGNSTAAGVAHALGLNLWPAEATREGTAYVSSEDLLKKPKLTVLFVSAT
EKDVPLATKLDSPIWRFVPARSAGRVGLVERNIWGFGGPMSALRLANTMTDTLLSLPAPG
VNKQER
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory