SitesBLAST
Comparing BPHYT_RS20410 FitnessBrowser__BFirm:BPHYT_RS20410 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AES2 Glucarate dehydratase; GDH; GlucD; D-glucarate dehydratase; EC 4.2.1.40 from Escherichia coli (strain K12) (see 3 papers)
75% identity, 98% coverage: 11:449/449 of query aligns to 7:446/446 of P0AES2
- Y150 (= Y154) mutation to F: Reduces activity 100-fold.
- K207 (= K211) active site, Proton acceptor; mutation to Q: Reduces activity 1000-fold.; mutation to R: Reduces activity 10000-fold.
- D235 (= D239) binding
- E266 (= E270) binding
- N289 (= N293) binding
- H339 (= H343) active site, Proton acceptor; mutation to A: Loss of activity.; mutation to N: Reduces activity 10000-fold.; mutation to Q: Reduces activity 1000-fold.
- N341 (= N345) mutation to D: Inactive in the dehydration reaction of D-glucarate, L-idarate, and 4F-Gluc.; mutation to L: Almost no effect on the dehydration reaction of D-glucarate, L-idarate, and 4F-Gluc.
- D366 (= D370) mutation D->A,N: Reduces activity over 100-fold.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1ecqA E. Coli glucarate dehydratase bound to 4-deoxyglucarate (see paper)
75% identity, 98% coverage: 11:449/449 of query aligns to 5:444/444 of 1ecqA
- active site: K203 (= K209), K205 (= K211), D233 (= D239), N235 (= N241), E258 (= E264), N287 (= N293), M288 (= M294), D311 (= D317), H337 (= H343), N339 (= N345), I363 (= I369)
- binding 4-deoxyglucarate: N25 (= N31), H30 (= H36), T101 (= T107), Y148 (= Y154), F150 (= F156), K205 (= K211), D233 (= D239), N235 (= N241), N287 (= N293), H337 (= H343), S338 (= S344), N339 (= N345), H366 (= H372), R420 (= R425)
- binding magnesium ion: D233 (= D239), E258 (= E264), N287 (= N293)
1ec9D E. Coli glucarate dehydratase bound to xylarohydroxamate (see paper)
75% identity, 98% coverage: 11:449/449 of query aligns to 5:444/444 of 1ec9D
- active site: K203 (= K209), K205 (= K211), D233 (= D239), N235 (= N241), E258 (= E264), N287 (= N293), M288 (= M294), D311 (= D317), H337 (= H343), N339 (= N345), I363 (= I369)
- binding magnesium ion: D233 (= D239), E258 (= E264), N287 (= N293)
- binding xylarohydroxamate: H30 (= H36), T101 (= T107), Y148 (= Y154), F150 (= F156), K205 (= K211), D233 (= D239), N235 (= N241), N287 (= N293), H337 (= H343), S338 (= S344), N339 (= N345), H366 (= H372), R420 (= R425)
1ec8A E. Coli glucarate dehydratase bound to product 2,3-dihydroxy-5-oxo- hexanedioate (see paper)
75% identity, 98% coverage: 11:449/449 of query aligns to 3:442/442 of 1ec8A
- active site: K201 (= K209), K203 (= K211), D231 (= D239), N233 (= N241), E256 (= E264), N285 (= N293), M286 (= M294), D309 (= D317), H335 (= H343), N337 (= N345), I361 (= I369)
- binding 2,3-dihydroxy-5-oxo-hexanedioate: N23 (= N31), H28 (= H36), T99 (= T107), Y146 (= Y154), K203 (= K211), D231 (= D239), N233 (= N241), N285 (= N293), H335 (= H343), S336 (= S344), N337 (= N345), H364 (= H372), R418 (= R425)
- binding magnesium ion: D231 (= D239), E256 (= E264), N285 (= N293)
1jctA Glucarate dehydratase, n341l mutant orthorhombic form (see paper)
75% identity, 98% coverage: 11:449/449 of query aligns to 4:443/443 of 1jctA
- active site: K202 (= K209), K204 (= K211), D232 (= D239), N234 (= N241), E257 (= E264), N286 (= N293), M287 (= M294), D310 (= D317), H336 (= H343), L338 (≠ N345), I362 (= I369)
- binding d-glucarate: N24 (= N31), H29 (= H36), T100 (= T107), Y147 (= Y154), F149 (= F156), K204 (= K211), D232 (= D239), N286 (= N293), S337 (= S344), R419 (= R425)
- binding magnesium ion: D232 (= D239), E257 (= E264), N286 (= N293)
3p0wB Crystal structure of d-glucarate dehydratase from ralstonia solanacearum complexed with mg and d-glucarate
70% identity, 97% coverage: 11:447/449 of query aligns to 2:428/428 of 3p0wB
- active site: K189 (= K209), K191 (= K211), D219 (= D239), N221 (= N241), E244 (= E264), N273 (= N293), D297 (= D317), H323 (= H343), N325 (= N345)
- binding d-glucarate: H27 (= H36), Y134 (= Y154), K191 (= K211), D219 (= D239), N221 (= N241), N273 (= N293), H323 (= H343), N325 (= N345), H352 (= H372), R406 (= R425)
- binding magnesium ion: D219 (= D239), E244 (= E264), N273 (= N293)
3nxlC Crystal structure of glucarate dehydratase from burkholderia cepacia complexed with magnesium
69% identity, 97% coverage: 11:447/449 of query aligns to 2:424/425 of 3nxlC
3nfuA Crystal structure of probable glucarate dehydratase from chromohalobacter salexigens dsm 3043 complexed with magnesium
61% identity, 97% coverage: 12:448/449 of query aligns to 3:440/441 of 3nfuA
- active site: K201 (= K209), K203 (= K211), D231 (= D239), N233 (= N241), E256 (= E264), N285 (= N293), D309 (= D317), H335 (= H343), N337 (= N345)
- binding magnesium ion: D231 (= D239), N233 (= N241), E256 (= E264), D257 (= D265), N285 (= N293)
3n6hB Crystal structure of mandelate racemase/muconate lactonizing protein from actinobacillus succinogenes 130z complexed with magnesium/sulfate
61% identity, 98% coverage: 10:449/449 of query aligns to 2:430/432 of 3n6hB
- active site: K189 (= K209), K191 (= K211), D219 (= D239), N221 (= N241), E244 (= E264), N273 (= N293), D297 (= D317), H323 (= H343), N325 (= N345)
- binding magnesium ion: D219 (= D239), E244 (= E264), N273 (= N293)
3pfrA Crystal structure of d-glucarate dehydratase related protein from actinobacillus succinogenes complexed with d-glucarate
61% identity, 98% coverage: 10:449/449 of query aligns to 1:426/426 of 3pfrA
- active site: K185 (= K209), K187 (= K211), D215 (= D239), N217 (= N241), E240 (= E264), N269 (= N293), D293 (= D317), H319 (= H343), N321 (= N345)
- binding d-glucarate: N22 (= N31), H27 (= H36), Y130 (= Y154), F132 (= F156), K187 (= K211), D215 (= D239), N217 (= N241), N269 (= N293), H319 (= H343), S320 (= S344), N321 (= N345), H348 (= H372)
- binding magnesium ion: D215 (= D239), E240 (= E264), N269 (= N293)
4it1D Crystal structure of enolase pfl01_3283 (target efi-502286) from pseudomonas fluorescens pf0-1 with bound magnesium, potassium and tartrate
37% identity, 95% coverage: 14:439/449 of query aligns to 6:421/427 of 4it1D
- active site: S51 (≠ V59), D54 (≠ G62), A98 (≠ L105), Y150 (= Y154), K194 (= K209), K196 (= K211), D224 (= D239), N226 (= N241), Y247 (= Y262), E249 (= E264), T271 (= T292), N272 (= N293), M273 (= M294), D296 (= D317), H323 (= H343), S324 (= S344), N325 (= N345), C349 (≠ I369), D350 (= D370)
- binding magnesium ion: D224 (= D239), E249 (= E264), N272 (= N293)
3vc6A Crystal structure of enolase tbis_1083(target efi-502310) from thermobispora bispora dsm 43833 complexed with magnesium and formate
35% identity, 96% coverage: 13:444/449 of query aligns to 3:417/420 of 3vc6A
- active site: D52 (≠ G62), H55 (≠ I65), Y146 (= Y154), K188 (= K209), K190 (= K211), D218 (= D239), N220 (= N241), E243 (= E264), N266 (= N293), M267 (= M294), D290 (= D317), H317 (= H343), S318 (= S344), N319 (= N345), H321 (= H347), C343 (≠ I369), D344 (= D370)
- binding magnesium ion: D218 (= D239), E243 (= E264), N266 (= N293)
3va8A Crystal structure of enolase fg03645.1 (target efi-502278) from gibberella zeae ph-1 complexed with magnesium, formate and sulfate
34% identity, 96% coverage: 13:445/449 of query aligns to 12:425/427 of 3va8A
3dg6A Crystal structure of muconate lactonizing enzyme from mucobacterium smegmatis complexed with muconolactone (see paper)
26% identity, 66% coverage: 116:410/449 of query aligns to 98:360/366 of 3dg6A
- active site: M134 (≠ A172), K160 (= K209), K162 (= K211), D191 (= D239), N193 (= N241), E217 (= E264), D242 (≠ A285), E243 (≠ T286), S244 (≠ G287), K266 (≠ Q309), G292 (= G341), N293 (≠ S342), Q294 (≠ H343), G319 (≠ A368), E320 (≠ I369), L321 (≠ D370)
- binding magnesium ion: D191 (= D239), E217 (= E264), D242 (≠ A285)
- binding [(2S)-5-oxo-2,5-dihydrofuran-2-yl]acetic acid: M134 (≠ A172), K160 (= K209), K162 (= K211), D191 (= D239), N193 (= N241), D242 (≠ A285), K266 (≠ Q309), N293 (≠ S342), Q294 (≠ H343), I295 (≠ S344)
Sites not aligning to the query:
2pmqB Crystal structure of a mandelate racemase/muconate lactonizing enzyme from roseovarius sp. Htcc2601 (see paper)
26% identity, 65% coverage: 115:406/449 of query aligns to 97:355/374 of 2pmqB
- active site: S135 (≠ A169), Q160 (≠ K209), K162 (= K211), D192 (= D239), E217 (= E264), D240 (vs. gap), E241 (≠ R283), K264 (≠ Q307), D291 (≠ N334), D292 (= D335), A293 (≠ T339), E316 (≠ D370), G317 (≠ T371), A318 (≠ H372), W319 (= W373)
- binding magnesium ion: D192 (= D239), E217 (= E264), D240 (vs. gap)
Sites not aligning to the query:
4h2hA Crystal structure of an enolase (mandalate racemase subgroup, target efi-502101) from pelagibaca bermudensis htcc2601, with bound mg and l-4-hydroxyproline betaine (betonicine) (see paper)
26% identity, 65% coverage: 115:406/449 of query aligns to 99:357/368 of 4h2hA
- active site: S137 (≠ A169), Q162 (≠ K209), K164 (= K211), D194 (= D239), E219 (= E264), D242 (vs. gap), E243 (≠ R283), K266 (≠ Q307), D293 (≠ N334), D294 (= D335), A295 (≠ T339), E318 (≠ D370), G319 (≠ T371), A320 (≠ H372), W321 (= W373)
- binding (2S,4R)-4-hydroxy-1,1-dimethylpyrrolidinium-2-carboxylate: Q162 (≠ K209), K164 (= K211), D242 (vs. gap), K266 (≠ Q307), A295 (≠ T339), W321 (= W373)
- binding magnesium ion: D194 (= D239), E219 (= E264), D242 (vs. gap)
Sites not aligning to the query:
3u4fA Crystal structure of a mandelate racemase (muconate lactonizing enzyme family protein) from roseovarius nubinhibens
27% identity, 65% coverage: 116:405/449 of query aligns to 86:356/371 of 3u4fA
- active site: S122 (≠ D160), K150 (= K209), R152 (≠ K211), D162 (vs. gap), D188 (= D239), N190 (= N241), F213 (≠ A263), E214 (= E264), D235 (≠ R284), G239 (≠ L288), E240 (≠ P289), Q261 (≠ D317), D263 (≠ H319), H290 (= H343), A292 (≠ N345), N293 (= N346), K313 (= K365), E316 (≠ A368), I319 (vs. gap), G321 (vs. gap)
- binding magnesium ion: D188 (= D239), E214 (= E264), S229 (≠ M279), L232 (≠ F282), E240 (≠ P289)
Sites not aligning to the query:
3rcyF Crystal structure of mandelate racemase/muconate lactonizing enzyme- like protein from roseovarius sp. Tm1035
25% identity, 81% coverage: 44:406/449 of query aligns to 25:370/397 of 3rcyF
- active site: K165 (≠ Q200), D167 (≠ R202), R175 (≠ K211), G208 (≠ D239), H210 (≠ N241), E234 (= E264), G259 (≠ N293), E260 (≠ M294), Q281 (≠ D317), A283 (≠ H319), H310 (= H343), A313 (≠ N346), L332 (≠ I366), E335 (≠ I369)
- binding magnesium ion: E234 (= E264), E260 (≠ M294)
- binding alpha-D-ribofuranose: R85 (= R98), P86 (≠ D99), P239 (≠ A269), A266 (≠ R300), E267 (≠ Q301)
2gghC The mutant a68c-d72c-nlq of deinococcus radiodurans nacylamino acid racemase (see paper)
25% identity, 77% coverage: 74:420/449 of query aligns to 75:368/370 of 2gghC
- active site: Y95 (≠ L110), S137 (≠ A169), K163 (= K209), K165 (= K211), R186 (= R235), T188 (= T237), D190 (= D239), N192 (= N241), E215 (= E264), D240 (≠ P289), E241 (≠ T290), S242 (≠ A291), K264 (≠ Q309), C290 (≠ S342), G291 (≠ H343), G292 (≠ S344), M293 (≠ N345), G316 (= G364), D317 (≠ K365), T318 (≠ I366)
- binding magnesium ion: D190 (= D239), E215 (= E264)
- binding n~2~-acetyl-l-glutamine: G292 (≠ S344), M293 (≠ N345), L294 (≠ N346)
Sites not aligning to the query:
4hpnA Crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops (see paper)
26% identity, 71% coverage: 96:412/449 of query aligns to 84:372/378 of 4hpnA
- active site: T134 (≠ S170), K164 (= K209), K166 (= K211), D194 (= D239), N196 (= N241), E220 (= E264), G245 (≠ N293), E246 (≠ M294), T247 (≠ I295), Q267 (≠ L315), D269 (= D317), H296 (= H343), V297 (≠ S344), W298 (vs. gap), R320 (≠ K365), E329 (vs. gap), F330 (vs. gap), H334 (= H372)
- binding calcium ion: D194 (= D239), D209 (vs. gap), E220 (= E264), G237 (≠ A285), E246 (≠ M294)
Sites not aligning to the query:
Query Sequence
>BPHYT_RS20410 FitnessBrowser__BFirm:BPHYT_RS20410
MSTKSSELNATPVVTELRVVPVAGRDSMLLNLSGAHGPFFTRNIVILRDSAGHTGVGEVP
GGESIRKTIDDARPLVVGQSIGNLQAVLNKARTQFADRDAGGRGLQTFDLRTTIHAVTAL
EAALLDLLGQHLGVPVAALLGEGQQRDEVEMLGYLFYIGDRKKTDLEYASGADGRDDWER
VRTEEAMTPEAVVRLAEAAQARYGFNDFKLKGGVLPGDAEIEAVTALAERFPKARVTLDP
NGAWSLAEAVRLCRDQHDVLAYAEDPCGAENGYSGREVMAEFRRATGLPTATNMIATDWR
QMGHAIQLQSVDIPLADPHFWTMQGSVRVAQMCNDWGLTWGSHSNNHFDISLAMFTHVAA
AAPGKITAIDTHWIWQDGQRLTRDPLRIVGGKVKVPQAAGLGIELDMDEIEKAHALYQQH
GLGARDDGVAMQYLIPNWKFDNKRPCLVR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory