Comparing BPHYT_RS20415 FitnessBrowser__BFirm:BPHYT_RS20415 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5hwnB Crystal structure of keto-deoxy-d-galactarate dehydratase complexed with pyruvate (see paper)
56% identity, 97% coverage: 4:299/305 of query aligns to 3:296/310 of 5hwnB
4ur8A Crystal structure of keto-deoxy-d-galactarate dehydratase complexed with 2-oxoadipic acid (see paper)
56% identity, 97% coverage: 4:299/305 of query aligns to 3:296/304 of 4ur8A
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
29% identity, 95% coverage: 13:303/305 of query aligns to 3:289/292 of Q07607
7mjfA Crystal structure of candidatus liberibacter solanacearum dihydrodipicolinate synthase with pyruvate and succinic semi-aldehyde bound in active site
26% identity, 90% coverage: 20:292/305 of query aligns to 10:280/296 of 7mjfA
Sites not aligning to the query:
7lvlA Dihydrodipicolinate synthase bound with allosteric inhibitor (s)- lysine from candidatus liberibacter solanacearum
26% identity, 90% coverage: 20:292/305 of query aligns to 10:280/296 of 7lvlA
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
27% identity, 93% coverage: 20:303/305 of query aligns to 10:291/294 of Q8UGL3
5ud6C Crystal structure of dhdps from cyanidioschyzon merolae with lysine bound
28% identity, 84% coverage: 41:295/305 of query aligns to 34:288/299 of 5ud6C
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
26% identity, 93% coverage: 20:303/305 of query aligns to 10:291/294 of 4i7wA
5ktlA Dihydrodipicolinate synthase from the industrial and evolutionarily important cyanobacteria anabaena variabilis. (see paper)
27% identity, 94% coverage: 15:302/305 of query aligns to 8:292/295 of 5ktlA
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
28% identity, 83% coverage: 38:290/305 of query aligns to 28:276/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
28% identity, 83% coverage: 38:290/305 of query aligns to 28:276/291 of 3u8gA
Sites not aligning to the query:
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
28% identity, 83% coverage: 38:290/305 of query aligns to 28:276/291 of 3tdfA
Sites not aligning to the query:
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
28% identity, 83% coverage: 38:290/305 of query aligns to 28:276/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
28% identity, 83% coverage: 38:290/305 of query aligns to 28:276/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
28% identity, 83% coverage: 38:290/305 of query aligns to 28:276/291 of 3pueB
3s8hA Structure of dihydrodipicolinate synthase complexed with 3- hydroxypropanoic acid(hpa)at 2.70 a resolution
31% identity, 57% coverage: 20:194/305 of query aligns to 10:186/292 of 3s8hA
Sites not aligning to the query:
3puoA Crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa(psdhdps)complexed with l-lysine at 2.65a resolution (see paper)
31% identity, 57% coverage: 20:194/305 of query aligns to 10:186/292 of 3puoA
Sites not aligning to the query:
4m19A Dihydrodipicolinate synthase from c. Jejuni with pyruvate bound to the active site and lysine bound to allosteric site (see paper)
31% identity, 55% coverage: 14:181/305 of query aligns to 6:176/296 of 4m19A
Sites not aligning to the query:
6u01B Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84d mutant with pyruvate bound in the active site (see paper)
31% identity, 55% coverage: 14:181/305 of query aligns to 6:176/296 of 6u01B
Sites not aligning to the query:
7kkdB Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84a mutant with pyruvate bound in the active site and r,r-bislysine bound at the allosteric site
31% identity, 55% coverage: 14:181/305 of query aligns to 16:186/306 of 7kkdB
>BPHYT_RS20415 FitnessBrowser__BFirm:BPHYT_RS20415
MTSPQELKAIVSEGLLSFPVTDFDAHGEFRADTYAARLEWLAPYGATALFAAGGTGEFFS
LTKTDYTNVIRTATDTCRGKVPILAGAGGPTRVAIEYAQEAERLGASGVLLMPHYLTEAS
QEGIAAHVEQVCKSVPNIGVIVYNRANSKLNADMLERLADRCPNLIGFKDGVGEIEAMVT
IRRRLGERFSYLGGLPTAEVYAAAYKALGVPVYSSAVFNFIPKTAMEFYRAVAANDHATQ
GRLLDEFFLPYLAIRNRRAGYAVSIVKAGAKLVGHDAGPVRAPLTDLTDEESAQLDALIR
KLGAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory