Comparing BPHYT_RS20560 FitnessBrowser__BFirm:BPHYT_RS20560 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
32% identity, 84% coverage: 29:295/316 of query aligns to 2:267/287 of 5dteB
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
31% identity, 77% coverage: 33:274/316 of query aligns to 5:247/288 of 1rpjA
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
31% identity, 77% coverage: 33:274/316 of query aligns to 5:247/288 of 1gudA
Sites not aligning to the query:
8wlbA X-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose (see paper)
30% identity, 87% coverage: 33:307/316 of query aligns to 5:276/288 of 8wlbA
8wl9A X-ray structure of enterobacter cloacae allose-binding protein in complex with d-ribose (see paper)
30% identity, 87% coverage: 33:307/316 of query aligns to 5:276/288 of 8wl9A
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
27% identity, 90% coverage: 32:315/316 of query aligns to 3:272/274 of 2ioyA
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
26% identity, 85% coverage: 32:299/316 of query aligns to 4:260/271 of 1dbpA
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
26% identity, 91% coverage: 29:315/316 of query aligns to 1:282/292 of 2fn8A
4rxmA Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
25% identity, 90% coverage: 32:315/316 of query aligns to 7:280/291 of 4rxmA
Sites not aligning to the query:
4rxmB Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
25% identity, 90% coverage: 32:315/316 of query aligns to 5:278/288 of 4rxmB
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
25% identity, 89% coverage: 32:312/316 of query aligns to 5:269/270 of 4zjpA
4irxA Crystal structure of caulobacter myo-inositol binding protein bound to myo-inositol (see paper)
27% identity, 91% coverage: 27:315/316 of query aligns to 6:286/296 of 4irxA
4wutA Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
25% identity, 90% coverage: 31:315/316 of query aligns to 2:279/290 of 4wutA
5ibqA Crystal structure of an abc solute binding protein from rhizobium etli cfn 42 (rhe_pf00037,target efi-511357) in complex with alpha-d-apiose
27% identity, 86% coverage: 32:304/316 of query aligns to 5:271/287 of 5ibqA
4ry0A Crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose
27% identity, 86% coverage: 32:304/316 of query aligns to 5:271/287 of 4ry0A
4rxtA Crystal structure of carbohydrate transporter solute binding protein arad_9553 from agrobacterium radiobacter, target efi-511541, in complex with d-arabinose
29% identity, 80% coverage: 63:315/316 of query aligns to 32:284/295 of 4rxtA
Sites not aligning to the query:
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
25% identity, 76% coverage: 58:297/316 of query aligns to 58:320/349 of A0QYB5
Sites not aligning to the query:
4rsmA Crystal structure of carbohydrate transporter msmeg_3599 from mycobacterium smegmatis str. Mc2 155, target efi-510970, in complex with d-threitol (see paper)
25% identity, 76% coverage: 58:297/316 of query aligns to 26:288/315 of 4rsmA
Sites not aligning to the query:
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
22% identity, 91% coverage: 30:315/316 of query aligns to 9:278/284 of 7e7mC
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
23% identity, 87% coverage: 41:315/316 of query aligns to 17:279/287 of 4yo7A
>BPHYT_RS20560 FitnessBrowser__BFirm:BPHYT_RS20560
MRRRVVIAGALAAAGIGGAADAAATPGGKLKIALVLKSLGDPFTIAMASAAQNYQQHYAS
QFDLTVRGTATESDTTGQIRMVEEMIKAKMNAIVIAPTDSKALTAVVARAIKAGVIVVSI
DNPLDEAFQDAAGISVPFVGPNNRKGAQQVSNYLAERLKTGDQVGVIEGSSADRNAQQRT
DGCRDAMNAAGINIVAVQTGDWEYGKGRDAASKMLSEHPQIRGLMCGNDNMAMGAVDAVR
DAGRTGGVYVTGYNDIDAIKPLIADGRVLATVNQFAARQAVFGVDVALKAVTEQRKQSEL
SSVIETPLQLVTAANH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory