Comparing BPHYT_RS20680 FitnessBrowser__BFirm:BPHYT_RS20680 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
38% identity, 83% coverage: 37:303/321 of query aligns to 2:267/287 of 5dteB
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
32% identity, 88% coverage: 40:321/321 of query aligns to 3:270/274 of 2ioyA
8wlbA X-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose (see paper)
33% identity, 86% coverage: 39:315/321 of query aligns to 3:276/288 of 8wlbA
8wl9A X-ray structure of enterobacter cloacae allose-binding protein in complex with d-ribose (see paper)
33% identity, 86% coverage: 39:315/321 of query aligns to 3:276/288 of 8wl9A
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
35% identity, 79% coverage: 39:292/321 of query aligns to 3:257/288 of 1rpjA
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
35% identity, 79% coverage: 39:292/321 of query aligns to 3:257/288 of 1gudA
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
32% identity, 88% coverage: 37:318/321 of query aligns to 1:265/271 of 1dbpA
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
28% identity, 89% coverage: 37:321/321 of query aligns to 1:280/292 of 2fn8A
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
31% identity, 82% coverage: 40:303/321 of query aligns to 5:256/270 of 4zjpA
4wutA Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
29% identity, 88% coverage: 39:321/321 of query aligns to 2:277/290 of 4wutA
4irxA Crystal structure of caulobacter myo-inositol binding protein bound to myo-inositol (see paper)
30% identity, 88% coverage: 39:320/321 of query aligns to 10:283/296 of 4irxA
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
29% identity, 76% coverage: 77:320/321 of query aligns to 37:285/313 of 2h3hA
Sites not aligning to the query:
5ibqA Crystal structure of an abc solute binding protein from rhizobium etli cfn 42 (rhe_pf00037,target efi-511357) in complex with alpha-d-apiose
29% identity, 80% coverage: 40:295/321 of query aligns to 5:251/287 of 5ibqA
4ry0A Crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose
29% identity, 80% coverage: 40:295/321 of query aligns to 5:251/287 of 4ry0A
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
29% identity, 76% coverage: 77:320/321 of query aligns to 37:285/305 of 3c6qC
Sites not aligning to the query:
4rxmB Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
26% identity, 84% coverage: 40:310/321 of query aligns to 5:266/288 of 4rxmB
4rxmA Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
26% identity, 84% coverage: 40:310/321 of query aligns to 7:268/291 of 4rxmA
Sites not aligning to the query:
5ocpA The periplasmic binding protein component of the arabinose abc transporter from shewanella sp. Ana-3 bound to alpha and beta-l- arabinofuranose
34% identity, 72% coverage: 85:314/321 of query aligns to 44:277/302 of 5ocpA
Sites not aligning to the query:
5dkvA Crystal structure of an abc transporter solute binding protein from agrobacterium vitis(avis_5339, target efi-511225) bound with alpha-d- tagatopyranose
27% identity, 82% coverage: 37:300/321 of query aligns to 6:271/303 of 5dkvA
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
26% identity, 88% coverage: 39:320/321 of query aligns to 7:276/287 of 4yo7A
>BPHYT_RS20680 FitnessBrowser__BFirm:BPHYT_RS20680
MIRHFLPARRRAIAAGAAFLAVSILPMPAAFAQAAHKPKVALVMKSLANEFFLTMETGAK
DYQKQNPAKFDLVTNGIKDETDTANQIRIVEQMIVSKVDALVIAPADSKALVPVLKKAVD
AGIIVVNIDNKLDNDVLKSKDLNIPFVGPDNAKGAQKVGDYLAKHLKSGDNVGIIEGVTT
TTNAQQRTAGFKQAMAAGGMKVVALQSGEWEIDKGNAVASQILNANPDVKALLCGNDNMA
IGAVSAVRAAGKAGKVQIVGYDDINAIKPMLKDGRVLATANQYAAKQAVFGIDTALKALS
EHKKQSELSGVVETPVDLVTK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory