SitesBLAST
Comparing BPHYT_RS20920 FitnessBrowser__BFirm:BPHYT_RS20920 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P77165 Aldehyde oxidoreductase iron-sulfur-binding subunit PaoA; EC 1.2.99.6 from Escherichia coli (strain K12) (see paper)
61% identity, 86% coverage: 26:180/181 of query aligns to 57:226/229 of P77165
- C99 (= C68) binding
- C104 (= C73) binding
- G105 (= G74) binding
- C107 (= C76) binding
- C119 (= C88) binding
- C158 (= C127) binding
- C161 (= C130) binding
- C208 (= C162) binding
- C210 (= C164) binding
5g5gA Escherichia coli periplasmic aldehyde oxidase (see paper)
62% identity, 83% coverage: 30:180/181 of query aligns to 10:175/175 of 5g5gA
- binding fe2/s2 (inorganic) cluster: G47 (= G67), C48 (= C68), D49 (= D69), G51 (= G71), C53 (= C73), G54 (= G74), C56 (= C76), C68 (= C88), C107 (= C127), G108 (= G128), C110 (= C130), C157 (= C162), C159 (= C164)
5y6qA Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
61% identity, 81% coverage: 30:176/181 of query aligns to 3:150/157 of 5y6qA
- binding fe2/s2 (inorganic) cluster: G40 (= G67), C41 (= C68), D42 (= D69), G44 (= G71), C46 (= C73), G47 (= G74), C49 (= C76), C61 (= C88), C101 (= C127), G102 (= G128), C104 (= C130), C136 (= C162), C138 (= C164)
- binding pterin cytosine dinucleotide: Q100 (= Q126), C138 (= C164)
4zohC Crystal structure of glyceraldehyde oxidoreductase (see paper)
48% identity, 83% coverage: 25:175/181 of query aligns to 5:154/161 of 4zohC
- binding fe2/s2 (inorganic) cluster: C47 (= C68), S50 (≠ G71), C52 (= C73), G53 (= G74), C55 (= C76), C67 (= C88), C106 (= C127), G107 (= G128), C109 (= C130), C141 (= C162), C143 (= C164)
- binding pterin cytosine dinucleotide: Q105 (= Q126), C143 (= C164)
1ffuD Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
45% identity, 82% coverage: 28:175/181 of query aligns to 1:148/156 of 1ffuD
- binding fe2/s2 (inorganic) cluster: C41 (= C68), S44 (≠ G71), H45 (≠ Q72), C46 (= C73), G47 (= G74), C49 (= C76), C61 (= C88), C100 (= C127), G101 (= G128), C103 (= C130), C135 (= C162), C137 (= C164)
1ffvA Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava (see paper)
46% identity, 80% coverage: 32:175/181 of query aligns to 4:147/155 of 1ffvA
- binding fe2/s2 (inorganic) cluster: I38 (≠ K66), C40 (= C68), S43 (≠ G71), C45 (= C73), G46 (= G74), C48 (= C76), C60 (= C88), C99 (= C127), G100 (= G128), C102 (= C130), C134 (= C162), C136 (= C164)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q98 (= Q126), C136 (= C164)
P19921 Carbon monoxide dehydrogenase small chain; CO dehydrogenase subunit S; CO-DH S; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
48% identity, 80% coverage: 32:175/181 of query aligns to 6:150/166 of P19921
- C42 (= C68) binding
- C47 (= C73) binding
- C50 (= C76) binding
- C62 (= C88) binding
- C102 (= C127) binding
- C105 (= C130) binding
- C137 (= C162) binding
- C139 (= C164) binding
1n5wD Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
48% identity, 80% coverage: 32:175/181 of query aligns to 4:148/158 of 1n5wD
- binding flavin-adenine dinucleotide: S43 (≠ G71), H44 (≠ Q72)
- binding fe2/s2 (inorganic) cluster: C40 (= C68), S43 (≠ G71), C45 (= C73), G46 (= G74), C48 (= C76), C60 (= C88), C100 (= C127), G101 (= G128), C103 (= C130), C135 (= C162), C137 (= C164)
- binding pterin cytosine dinucleotide: Q99 (= Q126), C137 (= C164)
1n5wA Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
48% identity, 80% coverage: 32:175/181 of query aligns to 4:148/161 of 1n5wA
- binding flavin-adenine dinucleotide: S43 (≠ G71), H44 (≠ Q72)
- binding fe2/s2 (inorganic) cluster: I38 (≠ K66), G39 (= G67), C40 (= C68), S43 (≠ G71), C45 (= C73), G46 (= G74), C48 (= C76), C60 (= C88), C100 (= C127), G101 (= G128), C103 (= C130), C135 (= C162), C137 (= C164)
1t3qA Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
45% identity, 80% coverage: 30:174/181 of query aligns to 4:148/162 of 1t3qA
- binding fe2/s2 (inorganic) cluster: I40 (≠ K66), C42 (= C68), E43 (≠ D69), G45 (= G71), C47 (= C73), G48 (= G74), C50 (= C76), R60 (≠ N86), C62 (= C88), C101 (= C127), G102 (= G128), C104 (= C130), C136 (= C162), C138 (= C164)
- binding pterin cytosine dinucleotide: Q100 (= Q126), C138 (= C164)
7dqxC Crystal structure of xanthine dehydrogenase family protein
46% identity, 76% coverage: 36:173/181 of query aligns to 10:148/160 of 7dqxC
- binding fe2/s2 (inorganic) cluster: C42 (= C68), G45 (= G71), V46 (≠ Q72), C47 (= C73), C50 (= C76), R60 (≠ N86), C62 (= C88), Q100 (= Q126), C101 (= C127), C104 (= C130), C137 (= C162), C139 (= C164)
- binding pterin cytosine dinucleotide: Q100 (= Q126), C139 (= C164)
1dgjA Crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 (see paper)
45% identity, 78% coverage: 34:174/181 of query aligns to 6:149/906 of 1dgjA
- binding fe2/s2 (inorganic) cluster: V38 (≠ K66), G39 (= G67), C40 (= C68), G41 (≠ D69), G43 (= G71), Q44 (= Q72), C45 (= C73), G46 (= G74), C48 (= C76), R58 (≠ N86), C60 (= C88), C100 (= C127), G101 (= G128), C103 (= C130), C137 (= C162), C139 (= C164)
- binding pterin cytosine dinucleotide: Q99 (= Q126), C139 (= C164)
Sites not aligning to the query:
- active site: 391, 427, 503, 507, 535, 869, 870
- binding molybdenum (iv)oxide: 424, 535, 698, 869
- binding pterin cytosine dinucleotide: 423, 424, 535, 652, 655, 656, 657, 658, 697, 698, 700, 702, 703, 799, 800, 803, 804, 807, 865, 866, 867, 868, 869
4usaA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with trans-cinnamaldehyde (see paper)
46% identity, 78% coverage: 34:174/181 of query aligns to 6:149/907 of 4usaA
- binding fe2/s2 (inorganic) cluster: V38 (≠ K66), C40 (= C68), E41 (≠ D69), G43 (= G71), C45 (= C73), G46 (= G74), C48 (= C76), R58 (≠ N86), C60 (= C88), C100 (= C127), G101 (= G128), C103 (= C130), C137 (= C162), C139 (= C164)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q126), C139 (= C164)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 531, 532, 535, 539
- binding hydrocinnamic acid: 255, 425, 494, 497, 535, 626
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us9A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with 3- phenylpropionaldehyde (see paper)
46% identity, 78% coverage: 34:174/181 of query aligns to 6:149/907 of 4us9A
- binding fe2/s2 (inorganic) cluster: V38 (≠ K66), C40 (= C68), E41 (≠ D69), G43 (= G71), C45 (= C73), G46 (= G74), C48 (= C76), R58 (≠ N86), C60 (= C88), C100 (= C127), G101 (= G128), C103 (= C130), C137 (= C162), C139 (= C164)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q126), C139 (= C164)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding 3-phenylpropanal: 255, 257, 258, 752
- binding bicarbonate ion: 460, 498, 531, 532, 535, 539, 890, 892
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4us8A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with benzaldehyde (see paper)
46% identity, 78% coverage: 34:174/181 of query aligns to 6:149/907 of 4us8A
- binding fe2/s2 (inorganic) cluster: V38 (≠ K66), C40 (= C68), E41 (≠ D69), G43 (= G71), C45 (= C73), G46 (= G74), C48 (= C76), R58 (≠ N86), C60 (= C88), C100 (= C127), G101 (= G128), C103 (= C130), C137 (= C162), C139 (= C164)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q126), C139 (= C164)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 498, 531, 532, 535, 539
- binding benzaldehyde: 255, 255, 394, 425, 425, 425, 425, 497, 497, 501, 531, 535, 535, 626, 626, 626, 694, 696, 697
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 653, 654, 655, 656, 695, 696, 697, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
4c7yA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide (see paper)
46% identity, 78% coverage: 34:174/181 of query aligns to 6:149/907 of 4c7yA
- binding fe2/s2 (inorganic) cluster: C40 (= C68), E41 (≠ D69), G43 (= G71), C45 (= C73), G46 (= G74), C48 (= C76), R58 (≠ N86), C60 (= C88), C100 (= C127), G101 (= G128), C103 (= C130), C137 (= C162), C139 (= C164)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q126), C139 (= C164)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding bicarbonate ion: 460, 498, 531, 535, 539
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
- binding hydrogen peroxide: 696, 697, 869
3fc4A Ethylene glycol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
46% identity, 78% coverage: 34:174/181 of query aligns to 6:149/907 of 3fc4A
- binding fe2/s2 (inorganic) cluster: V38 (≠ K66), C40 (= C68), E41 (≠ D69), G43 (= G71), C45 (= C73), G46 (= G74), C48 (= C76), R58 (≠ N86), C60 (= C88), C100 (= C127), G101 (= G128), C103 (= C130), C137 (= C162), C139 (= C164)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q126), C139 (= C164)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding 1,2-ethanediol: 535, 622, 696, 697, 869
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
3fahA Glycerol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
46% identity, 78% coverage: 34:174/181 of query aligns to 6:149/907 of 3fahA
- binding fe2/s2 (inorganic) cluster: V38 (≠ K66), C40 (= C68), E41 (≠ D69), G43 (= G71), C45 (= C73), G46 (= G74), C48 (= C76), R58 (≠ N86), C60 (= C88), C100 (= C127), G101 (= G128), C103 (= C130), C137 (= C162), C139 (= C164)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q126), C139 (= C164)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding glycerol: 416, 535, 622, 683, 696, 697, 869, 884, 889, 890, 892
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 419, 420, 421, 422, 533, 650, 653, 654, 655, 656, 695, 696, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
1sijA Crystal structure of the aldehyde dehydrogenase (a.K.A. Aor or mop) of desulfovibrio gigas covalently bound to [aso3]- (see paper)
46% identity, 78% coverage: 34:174/181 of query aligns to 6:149/907 of 1sijA
- binding fe2/s2 (inorganic) cluster: V38 (≠ K66), C40 (= C68), E41 (≠ D69), G43 (= G71), C45 (= C73), G46 (= G74), C48 (= C76), R58 (≠ N86), C60 (= C88), Q99 (= Q126), C100 (= C127), G101 (= G128), C103 (= C130), C137 (= C162), C139 (= C164)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q126), C139 (= C164)
Sites not aligning to the query:
- active site: 390, 425, 501, 505, 533, 869, 870
- binding arsenite: 535, 696, 697, 869
- binding magnesium ion: 899, 903
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): 420, 421, 422, 533, 653, 654, 655, 656, 695, 696, 698, 700, 701, 799, 800, 804, 807, 865, 866, 867, 868, 869
Q46509 Aldehyde oxidoreductase; Molybdenum iron sulfur protein; EC 1.2.99.7 from Megalodesulfovibrio gigas (Desulfovibrio gigas) (see paper)
46% identity, 78% coverage: 34:174/181 of query aligns to 6:149/907 of Q46509
- C40 (= C68) binding
- C45 (= C73) binding
- C48 (= C76) binding
- C60 (= C88) binding
- C100 (= C127) binding
- C103 (= C130) binding
- C137 (= C162) binding
- C139 (= C164) binding
Query Sequence
>BPHYT_RS20920 FitnessBrowser__BFirm:BPHYT_RS20920
MQQTASKTPQQSADPDAVRTTRQPSANATMPVELTVNGNLYTLSLDPRTTLLDALREHLH
LTGTKKGCDHGQCGACTVHVNGRRVNACLLLACAHAGDEITTIEGIGQPEALHPMQAAFV
ECDGYQCGYCTSGQIMSAVALLGEAVGPDDAEVREAMSGNLCRCGAYQNIVAAIQRVRGQ
S
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory